HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html A central region in the hepatitis C virus NS4A protein allows formation of an active NS3-NS4A serine proteinase complex in vivo and in vitro. A central region in the hepatitis C virus NS4A protein allows formation of an active NS3-NS4A serine proteinase complex in vivo and in vitro. J. Virol. (0022-538X) 1995 imex curation Lin C., Thomson J.A., Rice C.M. Virus - Publications including interactions involving viral proteins rice@borcim.wustl.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation mesau-bhk Mesocricetus auratus baby kidney cell line BHK bhk Golden (Syrian) Hamster baby kidney cell line BHK Established from the kidneys of five unsexed, one-day-old hamsters in 1961. anti bait coip anti bait coimmunoprecipitation anti bait coip autoradiography autoradiography Lin C., Thomson J.A., Rice C.M. Virus - Publications including interactions involving viral proteins rice@borcim.wustl.edu Accepted 2013-SEP-06 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 1995 imex curation p27958-pro_0000037574 Non-structural protein 4A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGKPAIIPDREVLYQEFDEMEEC 1658 1711 527EC748BC450589 p27958-pro_0000037573 Serine protease/helicase NS3 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQTYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPTGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAKGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADAGCSGGAYDIIICDECHSTDATSISGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLGFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMRKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVVT 1027 1657 5601AD5882D04C8F ns3-ns4a-2 1 NS3 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain NS4A 2 unspecified role unspecified role prey prey P27958-PRO_0000037574:p.Ile25_Val26delinsAlaAla mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain IV AA Thu Jul 07 12:07:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ile25ala_val26ala Fri Jul 22 10:51:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile25ala,val26ala' Wed May 02 14:52:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile_val25-26ala_ala' Tue Jun 30 18:31:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile25_Val26delinsAlaAla' P27958-PRO_0000037574:p.Gly27Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:20:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly27ala' Tue Jun 30 18:11:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly27Ala' P27958-PRO_0000037574:p.Arg28_Ile29delinsAlaLeu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain RI AL Thu Jul 07 12:07:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was arg28ala_ile29leu Fri Jul 22 11:01:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg28ala,ile29leu' Wed May 02 19:14:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_ile28-29ala_leu' Tue Jun 30 17:03:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg28_Ile29delinsAlaLeu' P27958-PRO_0000037574:p.Leu31_Ser32delinsAlaAla mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain LS AA Thu Jul 07 12:06:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was leu31ala_ser32ala Fri Jul 22 10:55:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu31ala,ser32ala' Wed May 02 15:33:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_ser31-32ala_ala' Tue Jun 30 16:24:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu31_Ser32delinsAlaAla' P27958-PRO_0000037574:p.Ile29Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I S Wed May 02 18:32:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile29ser' Tue Jun 30 19:08:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile29Ser' P27958-PRO_0000037574:p.Cys22_Val23delinsAlaLeu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain CV AL Thu Jul 07 12:07:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys22ala_val23leu Fri Jul 22 11:02:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys22ala,val23leu' Wed May 02 15:18:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys_val22-23ala_leu' Tue Jun 30 17:04:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys22_Val23delinsAlaLeu' P27958-PRO_0000037574:p.Val23_Ile25delinsAlaAlaVal mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain VVI AAV Thu Jul 07 12:06:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val23ala_val24ala_ile25val Fri Jul 22 11:03:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val23ala,val24ala,ile25val' Wed May 02 20:05:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_val_ile23-25ala_ala_val' Tue Jun 30 15:42:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val23_Ile25delinsAlaAlaVal' P27958-PRO_0000037574:p.Ile29_Leu31delinsAlaAlaVal mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain IVL AAV Thu Jul 07 12:06:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ile29ala_val30ala_leu31val Fri Jul 22 11:01:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile29ala,val30ala,leu31val' Wed May 02 15:02:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile_val_leu29-31ala_ala_val' Tue Jun 30 16:43:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile29_Leu31delinsAlaAlaVal' physical association physical association Fig. 4 and 6 ns3-ns4a-3 1 NS3 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain NS4A 2 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4 and 5