IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Zn-Induced Interactions Between SARS-CoV-2 orf7a and BST2/Tetherin. Zn-Induced Interactions Between SARS-CoV-2 orf7a and BST2/Tetherin. ChemistryOpen 2021 imex curation Petrosino M., Stellato F., Chiaraluce R., Consalvi V., La Penna G., Pasquo A., Proux O., Rossi G., Morante S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus rossig@roma2.infn.it Only protein-protein interactions imex curation in vitro In vitro biophysical biophysical predetermined predetermined participant predetermined Petrosino M., Stellato F., Chiaraluce R., Consalvi V., La Penna G., Pasquo A., Proux O., Rossi G., Morante S. Virus - Publications including interactions involving viral proteins X-ray Absorption Spectroscopy: used for determination of metal-ligand interactions. rossig@roma2.infn.it Accepted 2021-DEC-09 AT 13:29 GMT AT 13:29 GMT by LUANA ChemistryOpen 2021 Only protein-protein interactions imex curation imex curation zinc atom zinc atom 30Zn cinc zinc zincum Zink Zn Zn(II) Zn2+ zinc small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) bst2_human Bone marrow stromal antigen 2 BST2 Tetherin HM1.24 antigen protein protein human Homo sapiens Human MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ DIP protein Q10589 original sequence version: 87 DIP protein Q10589 original sequence version: 93 DIP protein Q10589 original sequence version: 92 CAF52340D69061EE ns7a_sars2 ORF7a protein Accessory protein 7a Protein U122 Protein X4 7a protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE bst2-ns7a_sars2-1 1 4 unspecified role unspecified role neutral component neutral component purified purified n terminal regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component partially purified partially purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 3 Both BST2 and both orf7a constructs (orf7aL1 (aa. 16–82) and orf7aL2 (aa. 15–82)) are able to bind Zn. ns7a_sars2-zinc atom-1 1 4 unspecified role unspecified role neutral component neutral component purified purified n terminal regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 3 Zn binds to both orf7a constructs: orf7aL1 (aa. 16–82) and orf7aL2 (aa. 15–82). The difference in spectra seen for orf7aL1 and orf7aL2, according to the results of XANES calculations, should be ascribed to the presence of the extra Cys15 Zn-ligand in orf7aL2. bst2-zinc atom-1 1 3 unspecified role unspecified role neutral component neutral component partially purified partially purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 3