IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ 2'-O methylation of RNA cap in SARS-CoV-2 captured by serial crystallography. 2'-O methylation of RNA cap in SARS-CoV-2 captured by serial crystallography. Proceedings of the National Academy of Sciences of the United States of America 2021 imex curation Wilamowski M., Sherrell DA., Minasov G., Kim Y., Shuvalova L., Lavens A., Chard R., Maltseva N., Jedrzejczak R., Rosas-Lemus M., Saint N., Foster IT., Michalska K., Satchell KJF., Joachimiak A. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus andrzejj@anl.gov Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wilamowski M., Sherrell DA., Minasov G., Kim Y., Shuvalova L., Lavens A., Chard R., Maltseva N., Jedrzejczak R., Rosas-Lemus M., Saint N., Foster IT., Michalska K., Satchell KJF., Joachimiak A. Virus - Publications including interactions involving viral proteins there are other molecules (MGP and 8NK, corresponding to m7Gppp and m7Gpp) present in two of the PDBe entries (7Jhe and 7Jpe) which I have not added, as a) they are not mentioned in the "sample preparation" and b) unclear to me what they are doing there/are really present. andrzejj@anl.gov Accepted 2021-JUN-07 AT 10:05 BST AT 10:05 BST by ORCHARD Proceedings of the National Academy of Sciences of the United States of America 2021 Only protein-protein interactions imex curation imex curation p0dtd1-pro_0000449628 Non-structural protein 10 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ 4254 4392 (n(7)-methyl 5'-triphospho-guanosine)-adenosine(2-) (N(7)-methyl 5'-triphospho-guanosine)-adenosine(2-) (N(7)-methyl 5'-triphospho-guanosine)-adenosine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p0dtd1-pro_0000449633 2'-O-methyltransferase nsp16 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 6799 7096 s-adenosyl-l-homocysteine S-adenosyl-l-homocysteine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) s-adenosyl-l-methionine S adenosyl Methionine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rep-rep-195 1 6 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 2 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supplementary Table 1/2 SAM rep-rep-192 1 3 unspecified role unspecified role neutral component neutral component adenosine_2′-O-ribose methylated residue carbohydrate chemical modification carbohydrate chemical modification carbohydrate chemical modification undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 2 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supplementary Table 1/2 Cap0, Cap1, SAM, SAH. rep-rep-193 1 3 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 2 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supplementary Table 1/2 Cap0, SAM. rep-rep-194 1 2 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component adenosine_2′-O-ribose methylated residue carbohydrate chemical modification carbohydrate chemical modification carbohydrate chemical modification undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supplementary Table 1/2 Cap1, SAH.