IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of SARS-CoV-2 nsp10 bound to nsp14-ExoN domain reveals an exoribonuclease with both structural and functional integrity. Crystal structure of SARS-CoV-2 nsp10 bound to nsp14-ExoN domain reveals an exoribonuclease with both structural and functional integrity. Nucleic acids research 2021 imex curation Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G., Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus lugw@scu.edu.cn Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G., Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Accepted 2021-MAY-24 AT 16:52 BST AT 16:52 BST by KALPANAP Nucleic acids research 2021 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 nsp10 bound to nsp14-ExoN domain reveals an exoribonuclease with both structural and functional integrity. Crystal structure of SARS-CoV-2 nsp10 bound to nsp14-ExoN domain reveals an exoribonuclease with both structural and functional integrity. Nucleic acids research 2021 imex curation Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G., Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus lugw@scu.edu.cn Only protein-protein interactions imex curation in vitro In vitro ribonuclease assay ribonuclease assay tag fluorescence tag visualisation by fluorescence tag fluorescence Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G., Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Accepted 2021-MAY-24 AT 16:52 BST AT 16:52 BST by KALPANAP Nucleic acids research 2021 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 nsp10 bound to nsp14-ExoN domain reveals an exoribonuclease with both structural and functional integrity. Crystal structure of SARS-CoV-2 nsp10 bound to nsp14-ExoN domain reveals an exoribonuclease with both structural and functional integrity. Nucleic acids research 2021 imex curation Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G., Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus lugw@scu.edu.cn Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G., Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Accepted 2021-MAY-24 AT 16:52 BST AT 16:52 BST by KALPANAP Nucleic acids research 2021 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 nsp10 bound to nsp14-ExoN domain reveals an exoribonuclease with both structural and functional integrity. Crystal structure of SARS-CoV-2 nsp10 bound to nsp14-ExoN domain reveals an exoribonuclease with both structural and functional integrity. Nucleic acids research 2021 imex curation Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G., Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus lugw@scu.edu.cn Only protein-protein interactions imex curation in vitro In vitro ribonuclease assay ribonuclease assay weight by staining molecular weight estimation by staining weight by staining Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G., Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G. Virus - Publications including interactions involving viral proteins CPX-5692 = Nsp10+14 =EBI-25564924 lugw@scu.edu.cn Accepted 2021-MAY-24 AT 16:52 BST AT 16:52 BST by KALPANAP Nucleic acids research 2021 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 nsp10 bound to nsp14-ExoN domain reveals an exoribonuclease with both structural and functional integrity. Crystal structure of SARS-CoV-2 nsp10 bound to nsp14-ExoN domain reveals an exoribonuclease with both structural and functional integrity. Nucleic acids research 2021 imex curation Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G., Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus lugw@scu.edu.cn Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G., Lin S., Chen H., Chen Z., Yang F., Ye F., Zheng Y., Yang J., Lin X., Sun H., Wang L., Wen A., Dong H., Xiao Q., Deng D., Cao Y., Lu G. Virus - Publications including interactions involving viral proteins CPX-5692 = Nsp10+14 =EBI-25564924 lugw@scu.edu.cn Accepted 2021-MAY-24 AT 16:52 BST AT 16:52 BST by KALPANAP Nucleic acids research 2021 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method magnesium dichloride magnesium dichloride [MgCl2] Magnesium chloride Magnesium chloride anhydrous Magnesiumchlorid MgCl2 magnesium dichloride small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p0dtd1-pro_0000449633 2'-O-methyltransferase nsp16 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 6799 7096 34-nt rna substrate rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) CACUAAUAAUAUCAAUGGAUUGAUAUUAUUAAUG p0dtd1-pro_0000449631 Proofreading exoribonuclease nsp14 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ 5926 6452 manganese(ii) chloride manganese(II) chloride Manganous chloride manganous dichloride manganese(2+) dichloride dichlorure de manganese Mangandichlorid Manganese bichloride Manganese(II) chloride (1:2) manganese(II) dichloride manganous chloride small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p0dtd1-pro_0000449628 Non-structural protein 10 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ 4254 4392 nsp10_nsp14_sars2_1-1 1 10 unspecified role unspecified role neutral component neutral component purified purified ExoN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Supplementary Table 1 34_nt rna substrate-magnesium dichloride-1 4 9 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme enzyme neutral component neutral component purified purified P0DTD1-PRO_0000449631:p.[Glu191Ala;His268Ala;Asp273Ala] mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain E A 22 certain certain sequence position certain certain certain sequence position certain H A 22 certain certain sequence position certain certain certain sequence position certain D A 22 Mon Jun 28 16:54:34 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu191Ala;His268Ala;Asp273Ala]' ExoN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 cofactor cofactor coenzyme ancillary ancillary chemical synthesis Chemical synthesis (Chemical synthesis) rna cleavage rna cleavage 5 C-F, 6 this RNA substrate does not blast to anything EDTA:CHEBI:42191 34_nt rna substrate-manganese(ii) chloride-1 4 9 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme enzyme neutral component neutral component purified purified P0DTD1-PRO_0000449631:p.[Glu191Ala;His268Ala;Asp273Ala] mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain E A 22 certain certain sequence position certain certain certain sequence position certain H A 22 certain certain sequence position certain certain certain sequence position certain D A 22 ExoN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 cofactor cofactor coenzyme ancillary ancillary chemical synthesis Chemical synthesis (Chemical synthesis) rna cleavage rna cleavage 5 C-F, 6 this RNA substrate does not blast to anything EDTA:CHEBI:42191 rep-rep-189 5 12 unspecified role unspecified role neutral component neutral component purified purified 10 unspecified role unspecified role neutral component neutral component purified purified ExoN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTD1-PRO_0000449631:p.[Glu191Ala;His268Ala;Asp273Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain D A Mon Jun 28 17:26:08 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu191Ala;His268Ala;Asp273Ala] [191-191, 268-268, 273-273]' direct interaction direct interaction Supp. figure 1 34_nt rna substrate-nsp10_nsp14_sars2_1-1 2 9 enzyme target enzyme target substrate substrate neutral component neutral component 5' prime fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme enzyme neutral component neutral component purified purified ExoN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTD1-PRO_0000449631:p.[Glu191Ala;His268Ala;Asp273Ala] mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain H A 22 certain certain sequence position certain certain certain sequence position certain D A 22 certain certain sequence position certain certain certain sequence position certain E A 22 ecoli Escherichia coli (strain K12) rna cleavage rna cleavage Supp. figure 6 this RNA substrate does not blast to anything rep-rep-190 3 10 unspecified role unspecified role prey prey cell lysate cell lysate ExoN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait cell lysate cell lysate Delta_alpha1 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp. figure 5 rep-rep-191 3 8 unspecified role unspecified role prey prey cell lysate cell lysate 12 unspecified role unspecified role bait bait cell lysate cell lysate Delta_alpha1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp. figure 5 No information is given regarding Nsp16 nsp10-nsp14_sars2-1 SARS-CoV-2 3'-5' exoribonuclease proof-reading complex NSP10:NSP14 SARS-CoV-2 NSP14/NSP10 complex 10 enzyme enzyme nsp10 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role nsp14 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 54 56 physical association physical association SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction The SARS-CoV-2 coronavirus 3'-5' exoribonuclease complex which strictly targets double-stranded RNA and can selectively remove a mismatched ribonucleotide at the 3'-end of a dsRNA substrate. Formation of the NSP10-NSP14 complex strongly enhances the exonuclease activity of the bifunctional NSP14 and enhances the fidelity of RNA synthesis by correcting nucleotide incorporation errors made by the RNA-dependent RNA polymerase. May bind to, and act with the nsp7/nsp8/nsp12 polymerase complex (CPX-5742). Proof-reading exonuclease activity may explain why coronaviruses have the largest RNA genomes known to date. Complex formation does not appear to effect the C-terminal N7-methyltransferase activity of NSP14 involved in RNA cap modification. Severe acute respiratory syndrome (SARS) [EFO:0000694]: A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death. NSP10 forms a homododecamer in isolation. A flexible N-terminal domain of NSP14 forms the NSP10 docking site and induces conformational changes in the NSP14 that modulate the distance between the catalytic residues. New version remark: PMID:29279395 describes nsp14 as a 3'-5'-exoribonuclease. See also review PMID:31440227. Description, properties and xrefs updated and GO added as per Sandra's addition on SARS-CoV entry EBI-25496027/CPX-5707. Also updated this entry to "by orthology" as SARS-CoV has exp-evidence. Accepted 2020-APR-20 by ORCHARD coronavirus