IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Neutrophil Elastase and Proteinase 3 Cleavage Sites Are Adjacent to the Polybasic Sequence within the Proteolytic Sensitive Activation Loop of the SARS-CoV-2 Spike Protein. Neutrophil Elastase and Proteinase 3 Cleavage Sites Are Adjacent to the Polybasic Sequence within the Proteolytic Sensitive Activation Loop of the SARS-CoV-2 Spike Protein. ACS omega 2021 imex curation Mustafa Z., Zhanapiya A., Kalbacher H., Burster T., Mustafa Z., Zhanapiya A., Kalbacher H., Burster T. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus for the resulting cleavage I have added the (Feature) Type as "identified peptide" - I cannot locate any other examples - though I have entered some before (as "Biological feature"??). Searching on (Feature) "resulting-cleavage" produces no results. timo.burster@nu.edu.kz Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Mustafa Z., Zhanapiya A., Kalbacher H., Burster T., Mustafa Z., Zhanapiya A., Kalbacher H., Burster T. Virus - Publications including interactions involving viral proteins for the resulting cleavage I have added the (Feature) Type as "identified peptide" - I cannot locate any other examples - though I have entered some before (as "Biological feature"??). Searching on (Feature) "resulting-cleavage" produces no results. SARS2 peptide was preincubated with Camostat and NE (neutrophil elastase) added. After incubation, the digestion pattern was resolved by HPLC. timo.burster@nu.edu.kz Accepted 2021-JUL-05 AT 08:21 BST AT 08:21 BST by KALPANAP ACS omega 2021 Only protein-protein interactions imex curation imex curation Neutrophil Elastase and Proteinase 3 Cleavage Sites Are Adjacent to the Polybasic Sequence within the Proteolytic Sensitive Activation Loop of the SARS-CoV-2 Spike Protein. Neutrophil Elastase and Proteinase 3 Cleavage Sites Are Adjacent to the Polybasic Sequence within the Proteolytic Sensitive Activation Loop of the SARS-CoV-2 Spike Protein. ACS omega 2021 imex curation Mustafa Z., Zhanapiya A., Kalbacher H., Burster T., Mustafa Z., Zhanapiya A., Kalbacher H., Burster T. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus for the resulting cleavage I have added the (Feature) Type as "identified peptide" - I cannot locate any other examples - though I have entered some before (as "Biological feature"??). Searching on (Feature) "resulting-cleavage" produces no results. timo.burster@nu.edu.kz Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay fingerprinting peptide massfingerprinting fingerprinting Mustafa Z., Zhanapiya A., Kalbacher H., Burster T., Mustafa Z., Zhanapiya A., Kalbacher H., Burster T. Virus - Publications including interactions involving viral proteins for the resulting cleavage I have added the (Feature) Type as "identified peptide" - I cannot locate any other examples - though I have entered some before (as "Biological feature"??). Searching on (Feature) "resulting-cleavage" produces no results. Digest products were resolved by reversed-phase HPLC prior to MS analysis. timo.burster@nu.edu.kz Accepted 2021-JUL-05 AT 08:21 BST AT 08:21 BST by KALPANAP ACS omega 2021 Only protein-protein interactions imex curation imex curation spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT prtn3_human Myeloblastin MBN PRTN3 Leukocyte proteinase 3 AGP7 Wegener autoantigen P29 C-ANCA antigen Neutrophil proteinase 4 protein protein human Homo sapiens Human MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP DIP protein P24158 original sequence version: 161 CBECA36D8C4B2A40 camostat camostat 4-{2-[(dimethylcarbamoyl)methoxy]-2-oxoethyl}phenyl 4-carbamimidamidobenzoate camostat camostatum N,N-dimethylcarbamoylmethyl 4-(4-guanidinobenzoyloxy)phenylacetate 4-{2-[2-(dimethylamino)-2-oxoethoxy]-2-oxoethyl}phenyl 4-carbamimidamidobenzoate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tryp_pig Trypsin protein protein pig Sus scrofa (Pig) Pig FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN DIP protein P00761 original sequence version: 122 mint A0A125CF7FC138C2 spike_sars Spike glycoprotein S E2 Peplomer protein 2 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIYQTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQDVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT DIP protein P59594 original sequence version: 48 catg_human Cathepsin G CTSG protein protein human Homo sapiens Human MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 6228E741E6A43889 elne_human Neutrophil elastase Elastase-2 ELANE PMN elastase Bone marrow serine protease Medullasin Human leukocyte elastase ELA2 protein protein human Homo sapiens Human MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH 3F7610DC33CAA4B9 elane-s-1 2 7 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain val663_Ser664 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain resulting-cleavage resulting-cleavage chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component purified purified human-leukocyte Homo sapiens leukocyte Leukocyte (white blood cell) protein cleavage protein cleavage 1A, number 1 ctsg-s-1 2 7 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Leu666_Arg667 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain resulting-cleavage resulting-cleavage chemical synthesis Chemical synthesis (Chemical synthesis) 8 enzyme enzyme neutral component neutral component purified purified human-neutrophil Homo sapiens polymorphonuclear neutrophil neutrophil Neutrophil [Neutrophilic granulocyte] protein cleavage protein cleavage 1A, number 2 prtn3-s-1 2 7 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain val663_Ser664 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain resulting-cleavage resulting-cleavage chemical synthesis Chemical synthesis (Chemical synthesis) 4 enzyme enzyme neutral component neutral component purified purified human-leukocyte Homo sapiens leukocyte Leukocyte (white blood cell) protein cleavage protein cleavage 1A, number 3 s-tryp_pig-1 2 6 enzyme enzyme neutral component neutral component purified purified pig-pancreas Pig pancreas pancreas 7 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Arg667_Ser668 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain resulting-cleavage resulting-cleavage chemical synthesis Chemical synthesis (Chemical synthesis) protein cleavage protein cleavage 1A, number 4 elane-s-2 2 3 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Val687_Ala688 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain resulting-cleavage resulting-cleavage chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component purified purified human-leukocyte Homo sapiens leukocyte Leukocyte (white blood cell) protein cleavage protein cleavage 1B, number 1 prtn3-s-2 2 3 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Val687_Ala688 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain resulting-cleavage resulting-cleavage chemical synthesis Chemical synthesis (Chemical synthesis) 4 enzyme enzyme neutral component neutral component purified purified human-leukocyte Homo sapiens leukocyte Leukocyte (white blood cell) protein cleavage protein cleavage 1B, number 2 s-tryp_pig-2 2 6 enzyme enzyme neutral component neutral component purified purified pig-pancreas Pig pancreas pancreas 3 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Arg682_Arg683 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain resulting-cleavage resulting-cleavage Arg683_Ala684 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain resulting-cleavage resulting-cleavage Arg685_Ser686 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain resulting-cleavage resulting-cleavage chemical synthesis Chemical synthesis (Chemical synthesis) protein cleavage protein cleavage 1B, number 3 elane-s-3 1 3 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Val687_Ala688 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain resulting-cleavage resulting-cleavage chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component purified purified human-leukocyte Homo sapiens leukocyte Leukocyte (white blood cell) protein cleavage protein cleavage Supp. figure 1 elane-s-4 1 5 inhibitor inhibitor neutral component neutral component 3 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Val687_Ala688 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain resulting-cleavage resulting-cleavage chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component purified purified human-leukocyte Homo sapiens leukocyte Leukocyte (white blood cell) protein cleavage protein cleavage Supp. figure 1 Only a high concentration (100 uM) of Camostat inhibited the turnover of the SARS2 peptide.