IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Alpha-1 antitrypsin inhibits TMPRSS2 protease activity and SARS-CoV-2 infection. Alpha-1 antitrypsin inhibits TMPRSS2 protease activity and SARS-CoV-2 infection. Nature communications 2021 imex curation Wettstein L., Weil T., Conzelmann C., Müller JA., Groß R., Hirschenberger M., Seidel A., Klute S., Zech F., Prelli Bozzo C., Preising N., Fois G., Lochbaum R., Knaff PM., Mailänder V., Ständker L., Thal DR., Schumann C., Stenger S., Kleger A., Lochnit G., Mayer B., Ruiz-Blanco YB., Hoffmann M., Sparrer KMJ., Pöhlmann S., Sanchez-Garcia E., Kirchhoff F., Frick M., Münch J. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Creative BioMart have stated that TMPRSS2-1856H was used in this publication. TMPRSS2 - no reply from authors regarding construct used. Creative BioMart sell several versions. jan.muench@uni-ulm.de Only protein-protein interactions imex curation in vitro In vitro cleavage cleavage assay cleavage predetermined predetermined participant predetermined Wettstein L., Weil T., Conzelmann C., Müller JA., Groß R., Hirschenberger M., Seidel A., Klute S., Zech F., Prelli Bozzo C., Preising N., Fois G., Lochbaum R., Knaff PM., Mailänder V., Ständker L., Thal DR., Schumann C., Stenger S., Kleger A., Lochnit G., Mayer B., Ruiz-Blanco YB., Hoffmann M., Sparrer KMJ., Pöhlmann S., Sanchez-Garcia E., Kirchhoff F., Frick M., Münch J. Virus - Publications including interactions involving viral proteins Creative BioMart have stated that TMPRSS2-1856H was used in this publication. TMPRSS2 - no reply from authors regarding construct used. Creative BioMart sell several versions. Cleavage of the peptide-MCA substrate generated fluorescent AMC (7-amino-4-methyl-coumarin), which was subsequently detected. jan.muench@uni-ulm.de Accepted 2021-MAY-13 AT 14:59 BST AT 14:59 BST by SIMONA Nature communications 2021 Only protein-protein interactions imex curation imex curation Alpha-1 antitrypsin inhibits TMPRSS2 protease activity and SARS-CoV-2 infection. Alpha-1 antitrypsin inhibits TMPRSS2 protease activity and SARS-CoV-2 infection. Nature communications 2021 imex curation Wettstein L., Weil T., Conzelmann C., Müller JA., Groß R., Hirschenberger M., Seidel A., Klute S., Zech F., Prelli Bozzo C., Preising N., Fois G., Lochbaum R., Knaff PM., Mailänder V., Ständker L., Thal DR., Schumann C., Stenger S., Kleger A., Lochnit G., Mayer B., Ruiz-Blanco YB., Hoffmann M., Sparrer KMJ., Pöhlmann S., Sanchez-Garcia E., Kirchhoff F., Frick M., Münch J. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Creative BioMart have stated that TMPRSS2-1856H was used in this publication. TMPRSS2 - no reply from authors regarding construct used. Creative BioMart sell several versions. jan.muench@uni-ulm.de Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wettstein L., Weil T., Conzelmann C., Müller JA., Groß R., Hirschenberger M., Seidel A., Klute S., Zech F., Prelli Bozzo C., Preising N., Fois G., Lochbaum R., Knaff PM., Mailänder V., Ständker L., Thal DR., Schumann C., Stenger S., Kleger A., Lochnit G., Mayer B., Ruiz-Blanco YB., Hoffmann M., Sparrer KMJ., Pöhlmann S., Sanchez-Garcia E., Kirchhoff F., Frick M., Münch J. Virus - Publications including interactions involving viral proteins Creative BioMart have stated that TMPRSS2-1856H was used in this publication. TMPRSS2 - no reply from authors regarding construct used. Creative BioMart sell several versions. jan.muench@uni-ulm.de Accepted 2021-MAY-13 AT 14:59 BST AT 14:59 BST by SIMONA Nature communications 2021 Only protein-protein interactions imex curation imex curation tmps2_human Transmembrane protease serine 2 TMPRSS2 PRSS10 Serine protease 10 protein protein human Homo sapiens Human MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG C05B5531C8A311C7 boc-gln-ala-arg-methylcoumarin Boc-Gln-Ala-Arg-methylcoumarin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) a1at_human Alpha-1-antitrypsin Alpha-1 protease inhibitor Alpha-1-antiproteinase AAT PI PRO0684 PRO2209 SERPINA1 Serpin A1 protein protein human Homo sapiens Human MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK DIP protein P01009 original sequence version: 186 DIP protein P01009-1 original sequence version: 182 7016555F273B7F16 camostat methanesulfonate camostat methanesulfonate Camostat mesilate Camostat monomethanesulfonate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) boc_gln_ala_arg_methylcoumarin-tmprss2-1 1 3 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) cleavage cleavage reaction cleavage 5D boc_gln_ala_arg_methylcoumarin-serpina1-1 1 3 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 inhibitor inhibitor neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma 4 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) cleavage cleavage reaction cleavage 5D boc_gln_ala_arg_methylcoumarin-camostat methanesulfonate-1 1 3 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 4 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) cleavage cleavage reaction cleavage 5D tmprss2-serpina1-1 2 5 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma 3 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast cleavage cleavage reaction cleavage Supp. figure 8 B/C