IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SARS-CoV-2 Spike protein binds to bacterial lipopolysaccharide and boosts proinflammatory activity. SARS-CoV-2 Spike protein binds to bacterial lipopolysaccharide and boosts proinflammatory activity. Journal of molecular cell biology 2020 imex curation Ganna Petruk, Manoj Puthia, Jitka Petrlova, Ann-Charlotte Stromdahl , Sven Kjellstrom, Artur Schmidtchen, Petruk G., Puthia M., Petrlova J., Samsudin F., Strömdahl AC., Cerps S., Uller L., Kjellström S., Bond PJ., Schmidtchen A. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus this was unassigned2536 artur.schmidtchen@med.lu.se 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Ganna Petruk, Manoj Puthia, Jitka Petrlova, Ann-Charlotte Stromdahl , Sven Kjellstrom, Artur Schmidtchen Virus - Publications including interactions involving viral proteins artur.schmidtchen@med.lu.se Accepted 2020-JUL-13 AT 10:49 BST AT 10:49 BST by KALPANAP 2020 imex curation SARS-CoV-2 Spike protein binds to bacterial lipopolysaccharide and boosts proinflammatory activity. SARS-CoV-2 Spike protein binds to bacterial lipopolysaccharide and boosts proinflammatory activity. Journal of molecular cell biology 2020 imex curation Ganna Petruk, Manoj Puthia, Jitka Petrlova, Ann-Charlotte Stromdahl , Sven Kjellstrom, Artur Schmidtchen, Petruk G., Puthia M., Petrlova J., Samsudin F., Strömdahl AC., Cerps S., Uller L., Kjellström S., Bond PJ., Schmidtchen A. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus this was unassigned2536 artur.schmidtchen@med.lu.se 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Ganna Petruk, Manoj Puthia, Jitka Petrlova, Ann-Charlotte Stromdahl , Sven Kjellstrom, Artur Schmidtchen Virus - Publications including interactions involving viral proteins artur.schmidtchen@med.lu.se Accepted 2020-JUL-13 AT 10:49 BST AT 10:49 BST by KALPANAP 2020 imex curation lipopolysaccharides Lipopolysaccharide small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT lipid a (e. coli) lipid A (E. coli) E. coli lipid A 2-deoxy-6-O-(2-deoxy-2-[(3R)-3-(dodecanoyloxy)tetradecanamido]-4-O-phosphono-3-O-[(3R)-3-(tetradecanoyloxy)tetradecanoyl]-beta-D-glucopyranosyl)-3-O-[(3R)-3-hydroxytetradecanoyl]-2-[(3R)-3-hydroxytetradecanamido]-1-O-phosphono-alpha-D-glucopyranose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cd14_human Monocyte differentiation antigen CD14 CD14 Myeloid cell-specific leucine-rich glycoprotein protein protein human Homo sapiens Human MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA DIP protein P08571 original sequence version: 96 DIP protein P08571 original sequence version: null 1746CDB41F394F8D spike_sars Spike glycoprotein S E2 Peplomer protein 2 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIYQTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQDVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT DIP protein P59594 original sequence version: 48 lipopolysaccharides-s-1 1 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie ms participant Identification by mass spectrometry ms participant western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Tue Sep 22 03:29:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg683Ala;Arg685Ala]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 1 A/B lipopolysaccharides-s-2 2 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified fluorescent label fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Wed Sep 16 10:27:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg683Ala;Arg685Ala]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1C the affinity of LPS to S protein was in the range of the one observed for LPS binding to the human receptor CD14. lipopolysaccharides-s-3 2 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified fluorescent label fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9inse 9inse direct interaction direct interaction 1C Positive control. lipopolysaccharides-s-4 1 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Fri Sep 18 22:42:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg683Ala;Arg685Ala]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified pseai Pseudomonas aeruginosa direct interaction direct interaction Supp. figure 2B lipid a (e. coli)-s-1 1 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Wed Sep 16 10:17:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg683Ala;Arg685Ala]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 2A/B lipopolysaccharides-s-5 1 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P59594:p.Arg667Ala mutation mutation certain certain sequence position certain certain certain sequence position certain R A Fri Sep 18 22:42:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg683Ala;Arg685Ala]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 2C