IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ IRF1 promotes innate immune response to viral infection through enhancing the activation of IRF3. IRF1 promotes innate immune response to viral infection through enhancing the activation of IRF3. Journal of virology 2020 imex curation Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H., Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus email sent 14/9/20: no reply expected! I have the PDf files from the library if you cannot access the journal. [Fig 6C + 6D sequences for IAD and Delta DBD construxts. Fig 7F - tags the same as 7E - the other cell line - notably FLAG-PP2A and V5-IRF3?] zhuhaizhen69@yahoo.com 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H., Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H. Virus - Publications including interactions involving viral proteins email sent 14/9/20: no reply expected! I have the PDf files from the library if you cannot access the journal. [Fig 6C + 6D sequences for IAD and Delta DBD construxts. Fig 7F - tags the same as 7E - the other cell line - notably FLAG-PP2A and V5-IRF3?] zhuhaizhen69@yahoo.com Accepted 2020-OCT-30 AT 08:22 GMT AT 08:22 GMT by ORCHARD Journal of virology 2020 Only protein-protein interactions imex curation imex curation IRF1 promotes innate immune response to viral infection through enhancing the activation of IRF3. IRF1 promotes innate immune response to viral infection through enhancing the activation of IRF3. Journal of virology 2020 imex curation Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H., Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus email sent 14/9/20: no reply expected! I have the PDf files from the library if you cannot access the journal. [Fig 6C + 6D sequences for IAD and Delta DBD construxts. Fig 7F - tags the same as 7E - the other cell line - notably FLAG-PP2A and V5-IRF3?] zhuhaizhen69@yahoo.com 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H., Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H. Virus - Publications including interactions involving viral proteins email sent 14/9/20: no reply expected! I have the PDf files from the library if you cannot access the journal. [Fig 6C + 6D sequences for IAD and Delta DBD construxts. Fig 7F - tags the same as 7E - the other cell line - notably FLAG-PP2A and V5-IRF3?] zhuhaizhen69@yahoo.com Accepted 2020-OCT-30 AT 08:22 GMT AT 08:22 GMT by ORCHARD Journal of virology 2020 Only protein-protein interactions imex curation imex curation IRF1 promotes innate immune response to viral infection through enhancing the activation of IRF3. IRF1 promotes innate immune response to viral infection through enhancing the activation of IRF3. Journal of virology 2020 imex curation Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H., Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus email sent 14/9/20: no reply expected! I have the PDf files from the library if you cannot access the journal. [Fig 6C + 6D sequences for IAD and Delta DBD construxts. Fig 7F - tags the same as 7E - the other cell line - notably FLAG-PP2A and V5-IRF3?] zhuhaizhen69@yahoo.com 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H., Wang J., Li H., Xue B., Deng R., Huang X., Xu Y., Chen S., Tian R., Wang X., Xun Z., Sang M., Zhu H. Virus - Publications including interactions involving viral proteins email sent 14/9/20: no reply expected! I have the PDf files from the library if you cannot access the journal. [Fig 6C + 6D sequences for IAD and Delta DBD construxts. Fig 7F - tags the same as 7E - the other cell line - notably FLAG-PP2A and V5-IRF3?] The amino acids sequences/ranges for the "IAD" and Delta DBD domains in IRF3 and IRF1 cannot be determined, and the authors did not reply to a request for information. zhuhaizhen69@yahoo.com Accepted 2020-OCT-30 AT 08:22 GMT AT 08:22 GMT by ORCHARD Journal of virology 2020 Only protein-protein interactions imex curation imex curation irf1_human Interferon regulatory factor 1 IRF1 protein protein human Homo sapiens Human MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP DIP protein P10914 original sequence version: 79 2E06245A212D1541 irf3_human Interferon regulatory factor 3 IRF3 protein protein human Homo sapiens Human MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES DIP protein Q14653 original sequence version: 96 DIP protein Q14653 original sequence version: 75 DIP protein Q14653 original sequence version: 95 DIP protein Q14653-1 original sequence version: 128 DIP protein Q14653 original sequence version: 119 F536676FA78B0110 pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 irf1-irf3-1 1 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization 6A After VSV infection colocalization took place in the nucleus. irf1-irf3-2 3 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6B irf3-irf1-1 3 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level IAD region sufficient to bind sufficient binding region sufficient to bind range range undetermined undetermined sequence position undetermined n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6C All forward primers for IRF3 deletion constructs have an identical sequence as given in Table 1; interacting regions have been entered based on reverse primers and deduced regions from figure 6C. The end of D-II region is aa 190, and the end of the D-III region is aa 386. the end of the D-IV region appears to map to aa 127, which would seem improbable. irf3-irf1-2 3 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range dbd required to bind necessary binding region required to bind range range range range physical association physical association 6D Primers given for IRF1 deletion constructs do not blat to the IRF1 gene. irf1-ppp2ca-1 3 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 competitor competitor competitor prey prey over-expressed over expressed level over-expressed region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7E ppp2ca-irf3-1 2 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7F it does not look as if IRF1-RED is part of the IP, but I may be wrong. Also IRF3 tag is unclear and PP2A tag also- assumed the same as figure 7E. Overexpression of IRF1 reduced the interaction between PP2A and IRF3. It has been assumed the tags on PP2A (Flag) and IRF3 (V5) are the same as for Figure 7E. irf3-ppp2ca-1 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7G Silencing IRF1 augmented the PP2A and IRF3 interaction. ppp2ca-irf3-2 3 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7H Depletion of the DBD domain of IRF1 resulted in loss of it's negative role on the interaction between PP2A and IRF3.