IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Cell 2020 imex curation Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA., Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait BT., Kapoor TM., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus darst@rockefeller.edu, campbee@rockefeller.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins darst@rockefeller.edu, campbee@rockefeller.edu Accepted 2020-SEP-16 AT 11:19 BST AT 11:19 BST by PPORRAS bioRxiv : the preprint server for biology 2020 Only protein-protein interactions imex curation imex curation Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Cell 2020 imex curation Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA., Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait BT., Kapoor TM., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus darst@rockefeller.edu, campbee@rockefeller.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight by staining molecular weight estimation by staining weight by staining Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins I have left Roles as Neutral, as there is no clear Bait/Prey. After PAGE the gel was stained with GelRed:- "an ultra sensitive, extremely stable and environmentally safe fluorescent nucleic acid dye designed to replace the highly toxic ethidium bromide (EtBr) for staining dsDNA, ssDNA or RNA in agarose gels or polyacrylamide gels." darst@rockefeller.edu, campbee@rockefeller.edu Accepted 2020-SEP-16 AT 11:19 BST AT 11:19 BST by PPORRAS bioRxiv : the preprint server for biology 2020 Only protein-protein interactions imex curation imex curation Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Cell 2020 imex curation Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA., Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait BT., Kapoor TM., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus darst@rockefeller.edu, campbee@rockefeller.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins darst@rockefeller.edu, campbee@rockefeller.edu Accepted 2020-SEP-16 AT 11:19 BST AT 11:19 BST by PPORRAS bioRxiv : the preprint server for biology 2020 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Cell 2020 imex curation Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA., Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait BT., Kapoor TM., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus darst@rockefeller.edu, campbee@rockefeller.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins darst@rockefeller.edu, campbee@rockefeller.edu Accepted 2020-SEP-16 AT 11:19 BST AT 11:19 BST by PPORRAS bioRxiv : the preprint server for biology 2020 Only protein-protein interactions imex curation imex curation Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Cell 2020 imex curation Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA., Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait BT., Kapoor TM., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus darst@rockefeller.edu, campbee@rockefeller.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro rna rna pol assay rna directed rna polymerase assay rna rna pol assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins darst@rockefeller.edu, campbee@rockefeller.edu Accepted 2020-SEP-16 AT 11:19 BST AT 11:19 BST by PPORRAS bioRxiv : the preprint server for biology 2020 Only protein-protein interactions imex curation imex curation Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Structural Basis for Helicase-Polymerase Coupling in the SARS-CoV-2 Replication-Transcription Complex. Cell 2020 imex curation Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA., Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait BT., Kapoor TM., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus darst@rockefeller.edu, campbee@rockefeller.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Chen J., Malone B., Llewellyn E., Grasso M., Shelton PMM., Olinares PDB., Maruthi K., Eng ET., Vatandaslar H., Chait B., Kapoor T., Darst SA., Campbell EA. Virus - Publications including interactions involving viral proteins The Kinase-Glo ® Luminescent Kinase Assay measures kinase activity by quantitating the amount of ATP remaining in solution following a kinase reaction. The luminescent signal produced is correlated with the amount of ATP present and is inversely correlated with the amount of kinase activity. Added Ultra-GloTM Luciferase catalyzes the mono-oxygenation of luciferin +ATP and produces one photon of light per turnover. darst@rockefeller.edu, campbee@rockefeller.edu Accepted 2020-SEP-16 AT 11:19 BST AT 11:19 BST by PPORRAS bioRxiv : the preprint server for biology 2020 Only protein-protein interactions imex curation imex curation p0dtd1-pro_0000449629 RNA-directed RNA polymerase nsp12 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ 4393 5324 atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p0dtd1-pro_0000449625 Non-structural protein 7 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQ 3860 3942 p0dtd1-pro_0000449630 Helicase nsp13 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQ 5325 5925 p0dtd1-pro_0000449626 Non-structural protein 8 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ 3943 4140 template-rna template-RNA nucleic acid nucleic acid synthetic construct synthetic construct CUAUCCCCAUGUGAUUUUAAUAGCUUCUUAGGAGAAUGACGUAGCAUGCUACGCG NCBI Blast gives partial match to NC_045512.2 [29831-29870] (SARS2 complete genome) for residues 1-40. product-rna p-RNA ds rna ds rna double stranded ribonucleic acid synthetic construct synthetic construct CGCGUAGCAUGCUACGUCAUUCUCCUAAGAAGCUA NCBI and Ensembl (BLAT/BLAST) give NO matches. (UCSC BLAT gives a partial match to chr14:70927135-70927153) aluminium trifluoride aluminium trifluoride small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rep-rep-114 5 18 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 14 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 11 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 20 22 physical association physical association Table S1 product_rna-rep-1 2 13 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 14 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 11 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 28 26 physical association physical association Figure 1B, Lane 6+7 Addition of ADP-AlF3, which inhibits nsp13 ATPase activity, sharpened the band. product_rna-nsp7_nsp8_nsp12_sars2-1 2 18 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 14 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 36 34 physical association physical association Figure 1B, Lanes 3,6,7. product_rna-rep-3 1 13 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 14 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 11 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 41 39 physical association physical association Figure 1C nsp7_nsp8_nsp12_sars2-product_rna-1 1 13 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 14 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 18 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 46 48 physical association physical association Figure 1C nsp7_nsp8_nsp12_sars2-product_rna-2 3 13 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 14 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 18 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 54 52 physical association physical association Figure S1B nsp7_nsp8_nsp12_sars2-product_rna-3 3 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Figure S1B nsp7_nsp8_nsp12_sars2-product_rna-4 6 13 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain synthetic construct synthetic construct 14 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain synthetic construct synthetic construct 18 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 64 62 rna elongation rna strand elongation rna elongation Figure S1C atp-rep-1 7 9 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 11 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) atpase reaction atpase reaction Supp. figure 2 A/B The ATPase activity of nsp13 was maintained within the complex. There appears to be no significant differences for Kcat and Km values for Nsp13 alone, and with RNA, and /or Nsp 7+8 +12. Kcat and Km values stated here are the average values from Figure S2A and S2b for Nsp13 alone. I cannot see what the differences are meant to be between what is presumably S2A and B (top and middle images probably). As the error bars are so big it is hard to say anything. Kcat and Km values stated here are the average values from Figure S2A and S2b for Nsp13 alone. There are no major changes for kinetic parameters in the other mixes tested. atp-rep-2 7 15 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 11 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) atpase reaction atpase reaction Supp. figure 2 C nsp7-nsp8-nsp12_sars2 SARS-CoV-2 polymerase complex NSP7:2xNSP8:NSP12 replication-transcription complex replication and transcription complex RTC central RTC C-RTC holo-RdRp complex holo-RNA-dependent RNA polymerase complex 12 enzyme enzyme nsp7_nsp8 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 enzyme enzyme nsp7_nsp8 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 enzyme enzyme nsp8_nsp12 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role nsp8_nsp12 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 74 80 74 78 76 80 76 78 physical association physical association SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction RNA-directed 5'-3' RNA polymerase of the SARS-CoV-2 coronavirus which consists of the main polymerase protein NSP12 and a stoichiometric variant of the primase complex (CPX-5690). Extends partially double-stranded RNA templates and is probably also required for transcription initiation, though the mechanism for this has yet to be determined. Complex formation enhances dsRNA binding of the individual protomers. Heterotetramer Severe acute respiratory syndrome (SARS) [EFO:0000694]: A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death. Primase complex without polymerase has a different stoichiometry (8:8). NSP12 possesses conserved motifs involved in template binding, NTP binding, and polymerization that assume a structure resembling a cupped “right hand”. The NSP7-NSP8 heterodimer binds to the index finger loop and may facilitates the interaction of NSP12 with additional components of the RNA synthesis machinery. The second NSP8 molecule binds close to the RNA template-binding channel. Accepted 2020-APR-20 by ORCHARD coronavirus