IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of SARS-CoV-2 nsp10/nsp16 2'-O-methylase and its implication on antiviral drug design. Crystal structure of SARS-CoV-2 nsp10/nsp16 2'-O-methylase and its implication on antiviral drug design. Signal transduction and targeted therapy 2020 imex curation Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus lugw@scu.edu.cn 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro thermal shift thermal shift binding thermal shift predetermined predetermined participant predetermined Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Accepted 2020-AUG-13 AT 11:25 BST AT 11:25 BST by ORCHARD Signal transduction and targeted therapy 2020 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 nsp10/nsp16 2'-O-methylase and its implication on antiviral drug design. Crystal structure of SARS-CoV-2 nsp10/nsp16 2'-O-methylase and its implication on antiviral drug design. Signal transduction and targeted therapy 2020 imex curation Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus lugw@scu.edu.cn 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Accepted 2020-AUG-13 AT 11:25 BST AT 11:25 BST by ORCHARD Signal transduction and targeted therapy 2020 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 nsp10/nsp16 2'-O-methylase and its implication on antiviral drug design. Crystal structure of SARS-CoV-2 nsp10/nsp16 2'-O-methylase and its implication on antiviral drug design. Signal transduction and targeted therapy 2020 imex curation Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus lugw@scu.edu.cn 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Accepted 2020-AUG-13 AT 11:25 BST AT 11:25 BST by ORCHARD Signal transduction and targeted therapy 2020 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 nsp10/nsp16 2'-O-methylase and its implication on antiviral drug design. Crystal structure of SARS-CoV-2 nsp10/nsp16 2'-O-methylase and its implication on antiviral drug design. Signal transduction and targeted therapy 2020 imex curation Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus lugw@scu.edu.cn 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Accepted 2020-AUG-13 AT 11:25 BST AT 11:25 BST by ORCHARD Signal transduction and targeted therapy 2020 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 nsp10/nsp16 2'-O-methylase and its implication on antiviral drug design. Crystal structure of SARS-CoV-2 nsp10/nsp16 2'-O-methylase and its implication on antiviral drug design. Signal transduction and targeted therapy 2020 imex curation Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus lugw@scu.edu.cn 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Accepted 2020-AUG-13 AT 11:25 BST AT 11:25 BST by ORCHARD Signal transduction and targeted therapy 2020 Only protein-protein interactions imex curation imex curation (n(7)-methyl 5'-triphospho-guanosine)-adenosine(2-) (N(7)-methyl 5'-triphospho-guanosine)-adenosine(2-) (N(7)-methyl 5'-triphospho-guanosine)-adenosine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p0dtd1-pro_0000449633 2'-O-methyltransferase nsp16 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 6799 7096 p0dtd1-pro_0000449628 Non-structural protein 10 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ 4254 4392 s-adenosyl-l-methionine S adenosyl Methionine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) sinefungin sinefungin (2S,5S)-2,5-diamino-6-[(2R,3S,R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]hexanoic acid 6,9-Diamino-1-(6-amino-9H-purin-9-yl)-1,5,6,7,8,9-hexadeoxy-beta-D-ribo-decofuranuronic acid 6,9-Diamino-1-(6-amino-9H-purin-9-yl)-1,5,6,7,8,9-hexadeoxydecofuranuronic acid A 9145 ADENOSYL-ORNITHINE Antibiotic A 9145 sinefungin sinefungina sinefungine sinefunginum (5S)-5-amino-6-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]-L-norleucine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) LMXOHSDXUQEUSF-YECHIGJVSA-N LMXOHSDXUQEUSF-YECHIGJVSA-N rep-rep-100 5 9 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Table S1 Results with and without additional SAM added during crystallization. rep-rep-101 4 9 unspecified role unspecified role neutral component neutral component cdna library cdna library chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified 7 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Figure 1 H/J The protein-complex with or without a denaturing-refolding cycle (to remove pre-bound SAM). Stoichiometry was determined to be ~1.0uM with the refolded protein, and ~0.3uM with the protein purified directly from E. coli. rep-rep-102 1 9 unspecified role unspecified role neutral component neutral component cdna library cdna library chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1 F/G The protein-complex with or without a denaturing-refolding cycle (to remove pre-bound SAM). There was a shift in melting-temperature with the addition of SAM. rep-rep-103 4 10 unspecified role unspecified role neutral component neutral component cdna library cdna library chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified 7 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Figure 1 I/K The protein-complex with or without a denaturing-refolding cycle (to remove pre-bound SAM). Stoichiometry was determined to be ~1.0uM with the refolded protein, and ~0.3uM with the protein purified directly from E. coli. rep-rep-104 1 10 unspecified role unspecified role neutral component neutral component cdna library cdna library chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1 F/G The protein-complex with or without a denaturing-refolding cycle (to remove pre-bound SAM). There was a shift in melting-temperature with the addition of Sinefungin. rep-rep-99 2 8 unspecified role unspecified role neutral component neutral component purified purified P0DTD1-PRO_0000449628:p.Tyr30Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y A Wed Sep 16 10:13:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p0dtd1-pro_0000449628:p.Tyr30Ala' 7 unspecified role unspecified role neutral component neutral component purified purified P0DTD1-PRO_0000449633:p.Lys137Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Wed Sep 16 10:05:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p0dtd1-pro_0000449633:p.Lys137Ala' n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Figure S1 A/C The protein-complex purified directly from E. coli -"co-expression". Stoichiometry based on molecular weight. rep-rep-105 3 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure S1 B The protein-complex after the denaturing-refolding cycle. Stoichiometry based on molecular weight. rep-rep-106 4 6 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified P0DTD1-PRO_0000449628:p.Tyr30Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A Fri Sep 18 22:30:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p0dtd1-pro_0000449628:p.Tyr30Ala' 7 unspecified role unspecified role neutral component neutral component purified purified P0DTD1-PRO_0000449633:p.Lys137Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Wed Sep 16 10:24:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p0dtd1-pro_0000449633:p.Lys137Ala' n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Figure S4 B/C The protein-complex purified directly from E. coli -"co-expression".