IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Proteasome activator PA28γ-dependent degradation of coronavirus disease (COVID-19) nucleocapsid protein. Proteasome activator PA28γ-dependent degradation of coronavirus disease (COVID-19) nucleocapsid protein. Biochemical and biophysical research communications 2020 imex curation Zhang H., Tu J., Cao C., Yang T., Gao L., Zhang H., Tu J., Cao C., Yang T., Gao L. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus PA28-gamma has been found to be of Human origin from PMIDs 15111123, 11432824 and 9501171 lcgao@bio.ecnu.edu.c 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang H., Tu J., Cao C., Yang T., Gao L., Zhang H., Tu J., Cao C., Yang T., Gao L. Virus - Publications including interactions involving viral proteins PA28-gamma has been found to be of Human origin from PMIDs 15111123, 11432824 and 9501171 lcgao@bio.ecnu.edu.c Accepted 2020-AUG-04 AT 16:05 BST AT 16:05 BST by KALPANAP Biochemical and biophysical research communications 2020 Only protein-protein interactions imex curation imex curation Proteasome activator PA28γ-dependent degradation of coronavirus disease (COVID-19) nucleocapsid protein. Proteasome activator PA28γ-dependent degradation of coronavirus disease (COVID-19) nucleocapsid protein. Biochemical and biophysical research communications 2020 imex curation Zhang H., Tu J., Cao C., Yang T., Gao L., Zhang H., Tu J., Cao C., Yang T., Gao L. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus PA28-gamma has been found to be of Human origin from PMIDs 15111123, 11432824 and 9501171 lcgao@bio.ecnu.edu.c 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cleavage cleavage assay cleavage predetermined predetermined participant predetermined Zhang H., Tu J., Cao C., Yang T., Gao L., Zhang H., Tu J., Cao C., Yang T., Gao L. Virus - Publications including interactions involving viral proteins PA28-gamma has been found to be of Human origin from PMIDs 15111123, 11432824 and 9501171 lcgao@bio.ecnu.edu.c Accepted 2020-AUG-04 AT 16:05 BST AT 16:05 BST by KALPANAP Biochemical and biophysical research communications 2020 Only protein-protein interactions imex curation imex curation Proteasome activator PA28γ-dependent degradation of coronavirus disease (COVID-19) nucleocapsid protein. Proteasome activator PA28γ-dependent degradation of coronavirus disease (COVID-19) nucleocapsid protein. Biochemical and biophysical research communications 2020 imex curation Zhang H., Tu J., Cao C., Yang T., Gao L., Zhang H., Tu J., Cao C., Yang T., Gao L. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus PA28-gamma has been found to be of Human origin from PMIDs 15111123, 11432824 and 9501171 lcgao@bio.ecnu.edu.c 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang H., Tu J., Cao C., Yang T., Gao L., Zhang H., Tu J., Cao C., Yang T., Gao L. Virus - Publications including interactions involving viral proteins PA28-gamma has been found to be of Human origin from PMIDs 15111123, 11432824 and 9501171 lcgao@bio.ecnu.edu.c Accepted 2020-AUG-04 AT 16:05 BST AT 16:05 BST by KALPANAP Biochemical and biophysical research communications 2020 Only protein-protein interactions imex curation imex curation psme3_human Proteasome activator complex subunit 3 PSME3 Proteasome activator 28 subunit gamma Activator of multicatalytic protease subunit 3 11S regulator complex subunit gamma Ki nuclear autoantigen protein protein human Homo sapiens Human MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY 116FAB47D60A26C0 ncap_sars2 Nucleoprotein N Nucleocapsid protein protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA n-68 3 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1A psme3-n-1 1 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B n-psme3-1 2 5 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro 4 enzyme enzyme neutral component neutral component purified purified n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage 1 E/F Human 20S proteasome It was found that nCoV N exhibits remarkable down-regulation in the presence of PA28g and the 20S proteasome, while PA28g or 20S proteasome alone serves no function in the degradation of nCoV N.