IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structure of replicating SARS-CoV-2 polymerase. Structure of replicating SARS-CoV-2 polymerase. Nature 2020 imex curation Hillen HS., Kokic G., Farnung L., Dienemann C., Tegunov D., Cramer P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus patrick.cramer@mpibpc.mpg.de Only protein-protein interactions imex curation in vitro In vitro rna rna pol assay rna directed rna polymerase assay rna rna pol assay tag fluorescence tag visualisation by fluorescence tag fluorescence Hillen HS., Kokic G., Farnung L., Dienemann C., Tegunov D., Cramer P. Virus - Publications including interactions involving viral proteins patrick.cramer@mpibpc.mpg.de Accepted 2020-JUN-15 AT 08:57 BST AT 08:57 BST by MARTA Nature 2020 Only protein-protein interactions imex curation imex curation Structure of replicating SARS-CoV-2 polymerase. Structure of replicating SARS-CoV-2 polymerase. Nature 2020 imex curation Hillen HS., Kokic G., Farnung L., Dienemann C., Tegunov D., Cramer P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus patrick.cramer@mpibpc.mpg.de Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hillen HS., Kokic G., Farnung L., Dienemann C., Tegunov D., Cramer P. Virus - Publications including interactions involving viral proteins patrick.cramer@mpibpc.mpg.de Accepted 2020-JUN-15 AT 08:57 BST AT 08:57 BST by MARTA Nature 2020 Only protein-protein interactions imex curation imex curation Structure of replicating SARS-CoV-2 polymerase. Structure of replicating SARS-CoV-2 polymerase. Nature 2020 imex curation Hillen HS., Kokic G., Farnung L., Dienemann C., Tegunov D., Cramer P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus patrick.cramer@mpibpc.mpg.de Only protein-protein interactions imex curation in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Hillen HS., Kokic G., Farnung L., Dienemann C., Tegunov D., Cramer P. Virus - Publications including interactions involving viral proteins patrick.cramer@mpibpc.mpg.de Accepted 2020-JUN-15 AT 08:57 BST AT 08:57 BST by MARTA Nature 2020 Only protein-protein interactions imex curation imex curation palindromic_rna_duplex_scaffold ds rna ds rna double stranded ribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) UUUUCAUGCUACGCGUAG p0dtd1-pro_0000449625 Non-structural protein 7 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQ 3860 3942 rna_substrate ds rna ds rna double stranded ribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) UUUUCAUGCUACGCGUAGUUUUCUACGCG p0dtd1-pro_0000449629 RNA-directed RNA polymerase nsp12 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ 4393 5324 p0dtd1-pro_0000449626 Non-structural protein 8 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ 3943 4140 rep-rep-76 3 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Extended Data Table 1 palindromic_rna_duplex_scaffold-rep-1 1 6 enzyme target enzyme target substrate substrate neutral component neutral component 5' FAM fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 ancillary ancillary neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 ancillary ancillary neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) rna elongation rna strand elongation rna elongation 1B,C rna sequence taken from methods palindromic_rna_duplex_scaffold-rep-2 2 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Extended Data Figure 1 A/B