IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ EIF4A2 interacts with the membrane protein of transmissible gastroenteritis coronavirus and plays a role in virus replication. EIF4A2 interacts with the membrane protein of transmissible gastroenteritis coronavirus and plays a role in virus replication. Research in veterinary science 2019 imex curation Song Z., Yang Y., Wang L., Wang K., Ran L., Xie Y., Huang L., Yang Z., Yuan P., Yu Q. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus At the end I curated this one even if it was porcine coronavirus because it was an easy one ;-) szh7678@126.com 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Song Z., Yang Y., Wang L., Wang K., Ran L., Xie Y., Huang L., Yang Z., Yuan P., Yu Q. Virus - Publications including interactions involving viral proteins At the end I curated this one even if it was porcine coronavirus because it was an easy one ;-) UniprotAc for RNA polymerase II transcription subunit XP_005653991.1 94 Centromere-related proteins E XP_013844806.1 could not be retrieved as they are obsolete entries. Not curated. szh7678@126.com Accepted 2020-APR-27 AT 07:20 BST AT 07:20 BST by KALPANAP Research in veterinary science 2019 Only protein-protein interactions imex curation imex curation EIF4A2 interacts with the membrane protein of transmissible gastroenteritis coronavirus and plays a role in virus replication. EIF4A2 interacts with the membrane protein of transmissible gastroenteritis coronavirus and plays a role in virus replication. Research in veterinary science 2019 imex curation Song Z., Yang Y., Wang L., Wang K., Ran L., Xie Y., Huang L., Yang Z., Yuan P., Yu Q. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus At the end I curated this one even if it was porcine coronavirus because it was an easy one ;-) szh7678@126.com 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Song Z., Yang Y., Wang L., Wang K., Ran L., Xie Y., Huang L., Yang Z., Yuan P., Yu Q. Virus - Publications including interactions involving viral proteins At the end I curated this one even if it was porcine coronavirus because it was an easy one ;-) szh7678@126.com Accepted 2020-APR-27 AT 07:20 BST AT 07:20 BST by KALPANAP Research in veterinary science 2019 Only protein-protein interactions imex curation imex curation EIF4A2 interacts with the membrane protein of transmissible gastroenteritis coronavirus and plays a role in virus replication. EIF4A2 interacts with the membrane protein of transmissible gastroenteritis coronavirus and plays a role in virus replication. Research in veterinary science 2019 imex curation Song Z., Yang Y., Wang L., Wang K., Ran L., Xie Y., Huang L., Yang Z., Yuan P., Yu Q. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus At the end I curated this one even if it was porcine coronavirus because it was an easy one ;-) szh7678@126.com 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation pig-iec Porcine intestinal epithelial crypt cells intestine-epithelial_crypt intestinal epithelial crypt cells (iec) confocal microscopy confocal microscopy immunostaining immunostaining Song Z., Yang Y., Wang L., Wang K., Ran L., Xie Y., Huang L., Yang Z., Yuan P., Yu Q. Virus - Publications including interactions involving viral proteins At the end I curated this one even if it was porcine coronavirus because it was an easy one ;-) pIECs infected with TGEV szh7678@126.com Accepted 2020-APR-27 AT 07:20 BST AT 07:20 BST by KALPANAP Research in veterinary science 2019 Only protein-protein interactions imex curation imex curation EIF4A2 interacts with the membrane protein of transmissible gastroenteritis coronavirus and plays a role in virus replication. EIF4A2 interacts with the membrane protein of transmissible gastroenteritis coronavirus and plays a role in virus replication. Research in veterinary science 2019 imex curation Song Z., Yang Y., Wang L., Wang K., Ran L., Xie Y., Huang L., Yang Z., Yuan P., Yu Q. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus At the end I curated this one even if it was porcine coronavirus because it was an easy one ;-) szh7678@126.com 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation pig-iec Porcine intestinal epithelial crypt cells intestine-epithelial_crypt intestinal epithelial crypt cells (iec) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Song Z., Yang Y., Wang L., Wang K., Ran L., Xie Y., Huang L., Yang Z., Yuan P., Yu Q. Virus - Publications including interactions involving viral proteins At the end I curated this one even if it was porcine coronavirus because it was an easy one ;-) pIECs infected with TGEV szh7678@126.com Accepted 2020-APR-27 AT 07:20 BST AT 07:20 BST by KALPANAP Research in veterinary science 2019 Only protein-protein interactions imex curation imex curation f1s215_pig Regulator of G-protein signaling 4 RGS4 protein protein pig Sus scrofa (Pig) Pig MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHSSSHSKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPRAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLANLSSCGSEKQKGAKSSTDCPSLVPQCA 6AE4AE9BC063DDA4 f1rnn5_pig P2X purinoceptor P2RX7 protein protein pig Sus scrofa (Pig) Pig MPAWCSWNDVFQYETNKVTRIQSMNYGTIKWFFHVLVFSYVSFALVSDKRYQRKESVISSVHTKVKGIAEVTQEIVENGLKKVVPSVLDTADYTFPLQGNSFFVMTNFLKTEGQEQGLCPEYPTRRTLCSSNQGCKKGWMDPQSKGIQTGRCVEYKGKQKTCEVSAWCPIEAVEEAPQPALLRSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPLCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTAKESSYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLIVYIGSTLSYFGLATVFIDFLINTYSNNCCRSHVYPCCKCCEPCAVNEYYYRKKCESIMEPKPTLKYVSFVDEPHIRMVDQRLLGRSLQDVKGEEVPRPPMDFTDLSRLPLSLHDPPFIPGQPEAIQLLSEEAAPKSSDCPDWCQCGNCLPSQLPDSHKCLEELCCRKKLGACITTSELFQKLVLSRGVLQFLLHYQEPLLVLDADSANSQLRHCAYRCYTIWRFGSQDLADFAILPSCCRWKIRREFPKSEGQYSGFQSPY 8F1A1A65A31D9FA3 vme1_cvppu Membrane protein M E1 glycoprotein Matrix glycoprotein Membrane glycoprotein 5 protein protein TGEV Porcine transmissible gastroenteritis coronavirus (strain Purdue) MKILLILACVIACACGERYCAMKSDTDLSCRNSTASDCESCFNGGDLIWHLANWNFSWSIILIVFITVLQYGRPQFSWFVYGIKMLIMWLLWPVVLALTIFNAYSEYQVSRYVMFGFSIAGAIVTFVLWIMYFVRSIQLYRRTKSWWSFNPETKAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLYAEGFKIAGGMNIDNLPKYVMVALPSRTIVYTLVGKKLKASSATGWAYYVKSKAGDYSTEARTDNLSEQEKLLHMV 56D6441D2ABBABF4 a0a4x1trk4_pig AIR carboxylase Multifunctional protein ADE2 Phosphoribosylaminoimidazole carboxylase Phosphoribosylaminoimidazole-succinocarboxamide synthase SAICAR synthetase protein protein pig Sus scrofa (Pig) Pig MLSPGRHYLSPPSCAVAAAAPSPLRTMATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNTITSCVFQLLQEAGIKTAFTRKCGETAFIAPKCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVEMFFKDDANNDPQWSEEQLIAANFCFAGLVIGQTEVDVMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKTESQCRVVVLMGSTSDLSHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAFPVISCPPLSPDWGAQDVWSSLRLPSGLGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRANVLNTWISLKQADKKIREGNL 7ACBE77C601D553E a6m930_pig RNA helicase EIF4A2 protein protein pig Sus scrofa (Pig) Pig MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI FAA7D3BA9D8C6DA0 a0a4x1v3c3_pig Small nuclear ribonucleoprotein Sm D3 SNRPD3 snRNP core protein D3 protein protein pig Sus scrofa (Pig) Pig MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR 59A6E78E860AA3E0 m-ade2-1 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 1 and Table 2 m-a0a4x1trk4_pig-1 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 1 and Table 2 m-snrpd3-1 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 1 and Table 2 m-rgs4-1 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 1 and Table 2 m-p2rx7-1 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 1 and Table 2 m-eif4a2-1 2 7 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 3A-B m-eif4a2-2 4 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level infection infection 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3C eif4a2-m-1 3 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level infection infection 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 4 The green fluorescence of M protein and the red fluorescence of EIF4A2 were observed to be partially overlapping in the cytoplasm