IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural and Biochemical Characterization of Endoribonuclease Nsp15 Encoded by Middle East Respiratory Syndrome Coronavirus. Structural and Biochemical Characterization of Endoribonuclease Nsp15 Encoded by Middle East Respiratory Syndrome Coronavirus. Journal of virology 2018 imex curation Zhang L., Li L., Yan L., Ming Z., Jia Z., Lou Z., Rao Z. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus RNA binding and enzymatic reactions were not captured as it was not possible to assign RNA molecules to an identifier. raozh@mail.tsinghua.edu.cn Only protein-protein interactions imex curation in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Zhang L., Li L., Yan L., Ming Z., Jia Z., Lou Z., Rao Z. Virus - Publications including interactions involving viral proteins RNA binding and enzymatic reactions were not captured as it was not possible to assign RNA molecules to an identifier. raozh@mail.tsinghua.edu.cn Accepted 2020-MAY-12 AT 08:32 BST AT 08:32 BST by KALPANAP Journal of virology 2018 Only protein-protein interactions imex curation imex curation Structural and Biochemical Characterization of Endoribonuclease Nsp15 Encoded by Middle East Respiratory Syndrome Coronavirus. Structural and Biochemical Characterization of Endoribonuclease Nsp15 Encoded by Middle East Respiratory Syndrome Coronavirus. Journal of virology 2018 imex curation Zhang L., Li L., Yan L., Ming Z., Jia Z., Lou Z., Rao Z. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus RNA binding and enzymatic reactions were not captured as it was not possible to assign RNA molecules to an identifier. raozh@mail.tsinghua.edu.cn Only protein-protein interactions imex curation in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Zhang L., Li L., Yan L., Ming Z., Jia Z., Lou Z., Rao Z. Virus - Publications including interactions involving viral proteins RNA binding and enzymatic reactions were not captured as it was not possible to assign RNA molecules to an identifier. raozh@mail.tsinghua.edu.cn Accepted 2020-MAY-12 AT 08:32 BST AT 08:32 BST by KALPANAP Journal of virology 2018 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Structural and Biochemical Characterization of Endoribonuclease Nsp15 Encoded by Middle East Respiratory Syndrome Coronavirus. Structural and Biochemical Characterization of Endoribonuclease Nsp15 Encoded by Middle East Respiratory Syndrome Coronavirus. Journal of virology 2018 imex curation Zhang L., Li L., Yan L., Ming Z., Jia Z., Lou Z., Rao Z. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus RNA binding and enzymatic reactions were not captured as it was not possible to assign RNA molecules to an identifier. raozh@mail.tsinghua.edu.cn Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang L., Li L., Yan L., Ming Z., Jia Z., Lou Z., Rao Z. Virus - Publications including interactions involving viral proteins RNA binding and enzymatic reactions were not captured as it was not possible to assign RNA molecules to an identifier. raozh@mail.tsinghua.edu.cn Accepted 2020-MAY-12 AT 08:32 BST AT 08:32 BST by KALPANAP Journal of virology 2018 Only protein-protein interactions imex curation imex curation Structural and Biochemical Characterization of Endoribonuclease Nsp15 Encoded by Middle East Respiratory Syndrome Coronavirus. Structural and Biochemical Characterization of Endoribonuclease Nsp15 Encoded by Middle East Respiratory Syndrome Coronavirus. Journal of virology 2018 imex curation Zhang L., Li L., Yan L., Ming Z., Jia Z., Lou Z., Rao Z. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus RNA binding and enzymatic reactions were not captured as it was not possible to assign RNA molecules to an identifier. raozh@mail.tsinghua.edu.cn Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang L., Li L., Yan L., Ming Z., Jia Z., Lou Z., Rao Z. Virus - Publications including interactions involving viral proteins RNA binding and enzymatic reactions were not captured as it was not possible to assign RNA molecules to an identifier. raozh@mail.tsinghua.edu.cn Accepted 2020-MAY-12 AT 08:32 BST AT 08:32 BST by KALPANAP Journal of virology 2018 Only protein-protein interactions imex curation imex curation k9n7c7-pro_0000422445 Non-structural protein 7 rep ORF1ab polyprotein 1a-1b protein protein cvemc Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (Betacoronavirus England 1) Betacoronavirus England 1 Human coronavirus EMC SKLTDLKCTSVVLLSVLQQLHLEANSRAWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQ 3846 3928 65B6E04A9EC606E5 k9n7c7-pro_0000422452 Uridylate-specific endoribonuclease rep ORF1ab polyprotein 1a-1b protein protein cvemc Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (Betacoronavirus England 1) Betacoronavirus England 1 Human coronavirus EMC GLENIAFNFVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLPTNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDIDVNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDVVKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGLENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNTAAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYPRLQ 6433 6775 59E0688ED9768917 k9n7c7-pro_0000422446 Non-structural protein 8 rep ORF1ab polyprotein 1a-1b protein protein cvemc Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (Betacoronavirus England 1) Betacoronavirus England 1 Human coronavirus EMC ATLSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKLERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPLSVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDSNENLTWPLVLECTRASTSAVKLQ 3929 4127 74898B23ACCEBAEA nsp15-hexamer-1 5 7 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 orf1ab-1 1 7 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range K9N7C7-PRO_0000422452:p.Asp39Ala D39A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 16:19:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp39Ala' K9N7C7-PRO_0000422452:p.Glu263Ala E263A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 16:02:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu263Ala' K9N7C7-PRO_0000422452:p.Asn38Ala N38A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain N A Tue Jun 30 18:36:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn38Ala' K9N7C7-PRO_0000422452:p.Tyr58Ala Y58A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 20:04:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr58Ala' K9N7C7-PRO_0000422452:p.Asn157Ala N157A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain N A Tue Jun 30 15:54:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn157Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 6A To validate the significance of the interfaces, analytical ultracentrifugation (AUC) analysis was conducted to assess the oligomeric forms of soluble and stable variants. Mutant D39A existed primarily as a hexamer, while mutant E263A was distributed equally between the monomer and hexamer states. By comparison, mutants N38A, Y58A, and N157A existed predominately as monomers (Fig. 6A). orf1ab-orf1ab-2 4 8 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range K9N7C7-PRO_0000422452:p.Asp39Ala D39A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 16:17:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp39Ala' K9N7C7-PRO_0000422452:p.Glu263Ala E263A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 20:10:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu263Ala' K9N7C7-PRO_0000422452:p.Asn38Ala N38A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N A Tue Jun 30 18:13:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn38Ala' K9N7C7-PRO_0000422452:p.Tyr58Ala Y58A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 18:36:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr58Ala' K9N7C7-PRO_0000422452:p.Asn157Ala N157A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N A Tue Jun 30 19:29:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn157Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 8A orf1ab-orf1ab-1 2 8 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 8B orf1ab-orf1ab-3 2 39 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 41 gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 43 his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 45 his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 47 gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 45 his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 43 ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 8C nsp7-nsp8_mers1-1 MERS-CoV primase complex 2xNSP7:2xNSP8 8 unspecified role unspecified role nsp8 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role nsp8 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role nsp7 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role nsp8 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 54 52 55 53 physical association physical association cvemc Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (Betacoronavirus England 1) Betacoronavirus England 1 Human coronavirus EMC stable complex stable complex biological system reconstruction evidence based on inference from background scientific knowledge used in manual assertion biological system reconstruction evidence based on inference from background scientific knowledge used in manual assertion Primase complex of the MERS coronavirus which binds dsRNA molecules and extends partially double-stranded RNA templates. Heterodimer Heterotrimer Heterotetramer Exists in potentially 3 different conformations: 1:1 heterodimers, heterotrimers of conformation 2xnsp7:1xnsp8 and 2:2 heterotetramers form by 2 heterodimers. Coronavirus infectious disease [EFO:0007224]: results in infection in animals and humans, has material basis in coronaviruses, which are transmitted by droplet spread of respiratory secretions or transmitted by ingestion of contaminated food. coronavirus Accepted 2021-JUN-30 by ORCHARD