MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Development and application of a recombination-based library versus library high- throughput yeast two-hybrid (RLL-Y2H) screening system. Development and application of a recombination-based library versus library high- throughput yeast two-hybrid (RLL-Y2H) screening system. Nucleic acids research 2018 imex curation Yang F., Lei Y., Zhou M., Yao Q., Han Y., Wu X., Zhong W., Zhu C., Xu W., Tao R., Chen X., Lin D., Rahman K., Tyagi R., Habib Z., Xiao S., Wang D., Yu Y., Chen H., Fu Z., Cao G. Virus - Publications including interactions involving viral proteins gcao@mail.hzau.edu.cn 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Yang F., Lei Y., Zhou M., Yao Q., Han Y., Wu X., Zhong W., Zhu C., Xu W., Tao R., Chen X., Lin D., Rahman K., Tyagi R., Habib Z., Xiao S., Wang D., Yu Y., Chen H., Fu Z., Cao G. Virus - Publications including interactions involving viral proteins gcao@mail.hzau.edu.cn Accepted 2020-AUG-08 AT 09:12 BST AT 09:12 BST by MGT Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation Development and application of a recombination-based library versus library high- throughput yeast two-hybrid (RLL-Y2H) screening system. Development and application of a recombination-based library versus library high- throughput yeast two-hybrid (RLL-Y2H) screening system. Nucleic acids research 2018 imex curation Yang F., Lei Y., Zhou M., Yao Q., Han Y., Wu X., Zhong W., Zhu C., Xu W., Tao R., Chen X., Lin D., Rahman K., Tyagi R., Habib Z., Xiao S., Wang D., Yu Y., Chen H., Fu Z., Cao G. Virus - Publications including interactions involving viral proteins gcao@mail.hzau.edu.cn 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Yang F., Lei Y., Zhou M., Yao Q., Han Y., Wu X., Zhong W., Zhu C., Xu W., Tao R., Chen X., Lin D., Rahman K., Tyagi R., Habib Z., Xiao S., Wang D., Yu Y., Chen H., Fu Z., Cao G. Virus - Publications including interactions involving viral proteins The 15 interaction between Calpain and Mycobacterium tuberculosis proteins were not included because it is not specified which calpain is. To establish a high-throughput system which allows simultaneous PPI screening between a bait library and a prey library, the bait and prey vectors of the conventional Y2H system from Clontech were modified to develop a novel recombination-based ‘library versus library’ Y2H system, designated RLL-Y2H (Figure (Figure1).1). The design of this system is based on the high efficient DNA integration ability of PhiC31 as well as its specific recognition sites, ATTB and ATTP (22,23). Basically, ATTB and ATTP sites were fused right behind the bait and prey genes, respectively. In the presence of PhiC31 integrase, the bait and prey plasmids will be irreversibly integrated into a single plasmid, in which the bait and prey genes are fused at tail-to-tail orientation with an ATTL linker in between (designated bait-ATTL-prey) I didn't add the interactions with calpain because it doesn't explain which one it is. gcao@mail.hzau.edu.cn Accepted 2020-AUG-08 AT 09:12 BST AT 09:12 BST by MGT Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation ephb_myctu Epoxide hydrolase B ephB Epoxide hydrolase EphB LH57_10545 Rv1938 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSQVHRILNCRGTRIHAVADSPPDQQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIKELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVWYQDYFAVQDGIITEIEEDLRGWLLGLTYTVSGEGMMAATKAAVDAGVDLESMDPIDVIRAGPLCMAEGARLKDAFVYPETMPAWFTEADLDFYTGEFERSGFGGPLSFYHNIDNDWHDLADQQGKPLTPPALFIGGQYDVGTIWGAQAIERAHEVMPNYRGTHMIADVGHWIQQEAPEETNRLLLDFLGGLRP grp1_mouse RAS guanyl-releasing protein 1 Rasgrp1 Rasgrp Calcium and DAG-regulated guanine nucleotide exchange factor II Ras guanyl-releasing protein protein protein mouse Mus musculus Mouse MGTLGKAREAPRKPCHGSRAGPKARLEAKSTNSPLPAQPSLAQITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRNNQLLQVMLTMHRIIISSAELLQKVMNLYKDALEKNSPGVCLKICYFVRYWITEFWIMFKMDASLTSTMEEFQDLVKANGEETHCHLIDTTQINSRDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHLKDLISLYEAMPDYLEDGKVNVQKLLALYNHINELVQLQEMAPPLDANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDLDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRIKSPAISTENISSVVPMSTLCPLGTKDLLHAPEEGSFIFQNGEIVDHSEESKDRTIMLLGVSSQKISVRLKRTVAHKSTQTESFPWVGGETTPGHFVLSSPRKSAQGALYVHSPASPCPSPALVRKRAFVKWENKESLIKPKPELHLRLRTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLGKSNHVLAQMDHGDSA tsc2_mouse Tuberin Tuberous sclerosis 2 protein homolog Tsc2 protein protein mouse Mus musculus Mouse MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEILRELSGECGLNNRIRMIGQICDVAKTKKLEEHAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQGDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELAEFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIASMVHMICLLCIRTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFIITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRSYMEDAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRKELQAVTWDILLDIIERLLQQLQNLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRPESSLLNLISYRAQSIHPAKDGWIQNLQLLMERFFRNECRSAVAIKVLDVLSFVLLIIRQFYEEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLSPPPELEERDLAVHSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYESLISHIQLHYKHGYSLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCLCDCMELDRASEKKASGPLSPPTGPPSPVPMGPAVRLGYLPYSLLFRVLLQCLKQESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSALCSMLSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDKTRQREMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMAIPLLEFLSTLARLPHLYRNFVPEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARAPKQGLNNSPPVKEFKESCAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGDLQGGSDSSSDPSTHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVGVLDTSAPYSPGGSASLGPQTAVAAKPEKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHGHAPVQVIVSATGCTAKPPTLPRSNTVASFSSLYQPSCQGQLHRSVSWADSAMVLEEGSPGETQVPVEPPELEDFEAALGTDRHCQRPDTYSRSSSASSQEEKSHLEELAAGGIPIERAISSEGARPAVDLSFQPSQPLSKSSSSPELQTLQDILGDLGDKIDIGRLSPEAKVRSQSGILDGEAATWSATGEESRITVPPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGINPSFVFLQLYHSPFFGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSSSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIKQGQFNFVHVIITPLDYKCNLLTLQCRKDGPACKCEWWRQPGEIVVWALPVVMELTVTILLCHLQMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQRIREEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYETGQRKRLISSVDDFTEFV Implicated as a tumor suppressor. May have a function in vesicular transport, but may also play a role in the regulation of cell growth arrest and in the regulation of transcription mediated by steroid receptors. Interaction between TSC1 and TSC2 may facilitate vesicular docking. Specifically stimulates the intrinsic GTPase activity of the ras-related protein RAP1A and RAB5. Suggesting a possible mechanism for its role in regulating cellular growth mint 913AB87194AADA5B irak4_mouse Interleukin-1 receptor-associated kinase 4 Irak4 protein protein mouse Mus musculus Mouse MNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTCELLFDWGTTNCTVGDLVDLLVQIELFAPATLLLPDAVPQTVKSLPPREAATVAQTHGPCQEKDRTSVMPMPKLEHSCEPPDSSSPDNRSVESSDTRFHSFSFHELKSITNNFDEQPASAGGNRMGEGGFGVVYKGCVNNTIVAVKKLGAMVEISTEELKQQFDQEIKVMATCQHENLVELLGFSSDSDNLCLVYAYMPNGSLLDRLSCLDGTPPLSWHTRCKVAQGTANGIRFLHENHHIHRDIKSANILLDKDFTAKISDFGLARASARLAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLELITGLAAVDENREPQLLLDIKEEIEDEEKTIEDYTDEKMSDADPASVEAMYSAASQCLHEKKNRRPDIAKVQQLLQEMSA DIP protein Q8R4K2 original sequence version: 107 DIP protein Q8R4K2 original sequence version: 98 DIP protein Q8R4K2 original sequence version: 77 FC11AD06983B7AEB e2ak3_mouse Eukaryotic translation initiation factor 2-alpha kinase 3 Eif2ak3 Pek Perk PRKR-like endoplasmic reticulum kinase Pancreatic eIF2-alpha kinase protein protein mouse Mus musculus Mouse MERATRPGPRALLLLLFLLLGCAAGISAVAPARSLLAPASETVFGLGAAAAPTSAARVPAVATAEVTVEDAEALPAAAGEPESRATEPDDDVELRPRGRSLVIISTLDGRIAALDAENDGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMEAVPFTVESLLESSYKFGDDVVLVGGKSLITYGLSAYSGKLRYICSALGCRRWDSDEMEEEEDILLLQRTQKTVRAVGPRSGSEKWNFSVGHFELRYIPDMETRAGFIESTFKPGGNKEDSKIISDVEEQEATMLDTVIKVSVADWKVMAFSRKGGRLEWEYQFCTPIASAWLVRDGKVIPISLFDDTSYTASEEALGDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRVSEKFPTSPKALESVNGENAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKYSHEEYSNGALSILQYPYDNGYYLPYYKRERNKRSTQITVRFLDSPHYSKNIRKKDPILLLHWWKEIFGTILLCIVATTFIVRRLFHPQPHRQRKESETQCQTESKYDSVSADVSDNSWNDMKYSGYVSRYLTDFEPIQCMGRGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLETPPEKWQEEMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEQIEVIAPSPERSRSFSVGISCGQTSSSESQFSPLEFSGTDCGDNSDSADAAYNLQDSCLTDCEDVEDGTVDGNDEGHSFELCPSEASPYTRSREGTSSSIVFEDSGCGNASSKEEPRGNRLHDGNHYVNKLTDLKCSSSRSSSEATTLSTSPTRPTTLSLDFTKNTVGQLQPSSPKVYLYIQMQLCRKENLKDWMNRRCSLEDREHGVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAMDQDEEEQTVLTPMPAYATHTGQVGTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYPFSTQMERVRILTDVRNLKFPLLFTQKYPQEHMMVQDMLSPSPTERPEATDIIENAIFENLEFPGKTVLRQRSRSMSSSGTKHSRQPSCSYSPLPGN DIP protein Q9Z2B5 original sequence version: 139 65A47D6C0DD2E046 dcdb_myctu dCTP deaminase, dUMP-forming dcd Bifunctional dCTP deaminase:dUTPase DCD-DUT MTCY63.26 Rv0321 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNNTRYTHIDPAKQQDELTSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCMLRLTSPSEHPYGSSRAGSKYQGQRGPTPSRSYQNFIRST i6y946_myctu Rv0925c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTTTSDQNAAAPPRFDGLRALFINATLKRSPELSHTDGLIERSSGIMREHGVQVDTLRAVDHDIATGVWPDMTEHGWATDEWPALYRRVLDAHILVLCGPIWLGDNSSVMKRVIERLYACSSLLNEDGQYAYYGRAGGCLITGNEDGVKHCAMNVLYSLQHLGYTIPPQADAGWIGEAGPGPSYLDPGSGGPENDFTNRNTTFMTFNLMHIAQMLRVAGGIPAYGNQRTKWDAGCRPDFANPDYR espl_myctu ESX-1 secretion-associated protein EspL espL Rv3880c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSMDELDPHVARALTLAARFQSALDGTLNQMNNGSFRATDEAETVEVTINGHQWLTGLRIEDGLLKKLGAEAVAQRVNEALHNAQAAASAYNDAAGEQLTAALSAMSRAMNEGMA relb_mouse Transcription factor RelB Relb protein protein mouse Mus musculus Mouse MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGLDGTQLSEMPRLVPRGPASLSSVTLGPAAPPPPATPSWSCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHGIESKRRKKKPVFLDHFLPGHSSGLFLPPSALQPADSDFFPASISLPGLEPPGGPDLLDDGFAYDPSAPTLFTMLDLLPPAPPLASAVVGSGGAGATVVESSGPEPLSLDSFAAPGPGDVGTASLVGSNMFPNQYREAAFGGGLLSPGPEAT DIP protein Q04863 original sequence version: 82 AA49781A891ED7B8 y2280_myctu Uncharacterized FAD-linked oxidoreductase Rv2280 Rv2280 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSEMTARFSEIVGNANLLTGDAIPEDYAHDEELTGPPQKPAYAAKPATPEEVAQLLKAASENGVPVTARGSGCGLSGAARPVEGGLLISFDRMNKVLEVDTANQVAVVQPGVALTDLDAATADTGLRYTVYPGELSSSVGGNVGTNAGGMRAVKYGVARHNVLGLQAVLPTGEIIRTGGRMAKVSTGYDLTQLIIGSEGTLALVTEVIVKLHPRLDHNASVLAPFADFDQVMAAVPKILASGLAPDILEYIDNTSMAALISTQNLELGIPDQIRDSCEAYLLVALENRIADRLFEDIQTVGEMLMELGAVDAYVLEGGSARKLIEAREKAFWAAKALGADDIIDTVVPRASMPKFLSTARGLAAAADGAAVGCGHAGDGNVHMAIACKDPEKKKKLMTDIFALAMELGGAISGEHGVGRAKTGYFLELEDPVKISLMRRIKQSFDPAGILNPGVVFGDT esxo_myctu ESAT-6-like protein EsxO esxO MTCY98.15c Rv2346c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTINYQFGDVDAHGAMIRAQAGLLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA C740622D0BB7C8CA socs3_mouse Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 Protein EF-10 Cis3 Cish3 Socs3 protein protein mouse Mus musculus Mouse MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL DIP protein O35718 original sequence version: 61 DIP protein O35718 original sequence version: 119 DIP protein O35718 original sequence version: 93 CD3859561D4CCDED o07422_myctu Rv0178 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MEDQQSASGDLTQKSVANGESTDTASAATEGHRGEIDAAGEPDERGAAVADSQADEDDSAATAARGGKTRARRSRGRRLAITVGVAAALFVGSAAFAGATVEPYLSERAVVATKLMVARTAANAITTLWTYTPENMDTLADRAANYLSGDFAAQYRRFVDQIAAANKQAKITNDTEVTGAAVESLSGRDAVAIVYTNTTTTSPVTKNIPALKYLSYRLFMKRYDARWLVTRMTTITSLDLTPQV aspat_myctu Aspartate aminotransferase Rv3722c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSFDSLSPQELAALHARHQQDYAALQGMKLALDLTRGKPSAEQLDLSNQLLSLPGDDYRDPEGTDTRNYGGQHGLPGLRAIFAELLGIAVPNLIAGNNSSLELMHDIVAFSMLYGGVDSPRPWIQEQDGIKFLCPVPGYDRHFAITETMGIEMIPIPMLQDGPDVDLIEELVAVDPAIKGMWTVPVFGNPSGVTYSWETVRRLVQMRTAAPDFRLFWDNAYAVHTLTLDFPRQVDVLGLAAKAGNPNRPYVFASTSKITFAGGGVSFFGGSLGNIAWYLQYAGKKSIGPDKVNQLRHLRFFGDADGVRLHMLRHQQILAPKFALVAEVLDQRLSESKIASWTEPKGGYFISLDVLPGTARRTVALAKDVGIAVTEAGASFPYRKDPDDKNIRIAPSFPSVPDLRNAVDGLATCALLAATETLLNQGLASSAPNVR atg2b_mouse Autophagy-related protein 2 homolog B Atg2b protein protein mouse Mus musculus Mouse MPWPFSESIKKRACRYLLQRYLGHFLQEKLSLEQLSLDLYQGTGSLAQVPLDKWCLNEILESADAPLEVTEGFIQSISLSVPWGSLLQDNCALEVRGLEMVFRPRPRVATGSEPMYWSSFMTSSMQLAKECLSQKLTDEQGEASQPFEGLEKFAETIETVLRRVKVTFIDTVLRIEHVPENSKTGAALEIRVDRTVYCDETADESSGVNVHQPTAFAHKLLQLSGVSLFWDEFSASAKSSPVCSTAPVETEPKLSPSWNPKIVYEPHPQLTRTLPEIAPSDPVQIGRLLGRLELSLTLKQNEVLPGAKLDVDGQIDSFHLFLSPRQVHLLLDMLAAIAGPENSSKIGLANKDRKNRPMQQEDEYRIQMELNRYYLRKDSLSMGVSSEKSFYETETARTPSSREEEVFFSMADMDMSHSLSSLPPLGDPPHMDLELSLTSTYTNTPAGSPLSATVLQPTWGEFADHKEQPVRGPAFQSDVVHPASLQKAALSSRSASVDESRPEFICRLALGIFSVSVLHIDPLSPAETSLNVNPLTRMATDFFSCVEKMDPAIFSTGDFKSFRAVFAEACSHDHLRFIGTGIKVSYEQRQRSASRHFSTDMSVGQMEFLECLFPTDCHSVPSHYTELLTFHSKEGTDAHLPVCLQLHYKHSETRGPQGNQARLSSVPQKAELQIKLNPVCCELDISIVDRLNSLLQPQKLTTVEMMASHMYASYNKHISLHKAFTEVFLDDSHSPANRRVSVQVATPALHLSVRFPIPDLRSDQERGPWFKKSLQKETLHLEFTDLESKTEFVGGSTPEQTKLELTFRELSGSFQEEKGGPSVKFFHVSGGVDGDTASSDDFDWPRMVLKINPPAMHSILERIAAEEEEENDGHYQEEEDGGAHSLKDVCDLRRPAPSPFSSRRVMFENEQMVMPGDPVEMTEFQDKAISNSHYVLELLLPNIHLTLPNKGFYEKLYNRIFNDLLLWEPTAPSPVETLENVSYGIGLSVASQLINTFSKDSFSPFKSAVHYDEDSGSEEETLQYFSAVDPNYRSRRKKKLDSQNKNSQSFLSVLLSINHGLMAVFTDVKQENGDPMESKHGEFWLEFNSGSFFCVTKYEGFEDKHYICLHSSSLRLYHKGIVDGAILPTETRLPCSTRPHWLEPTIYSSEEDGLSRTASDGVGGDNLNMLSVAVKILSDKSESNTKEFLVAVGLKGATLQHRVLPAGLSWHEQILNFLNIADEPVLGYNPPTSFTTFHVHLWSCALDYRPLHLPLRSLLTVETFSISSSVALDKSSSTLRIIMDEAALHLSDKCNTVTVNLNRDYVRVMDMGLLELTITAVKSDSDGEQTAPRFELHCSSDVVHIRTCSDSCAALMNLIQYVASYGDLHGPHKAEMKPGVPQRKPKVDSSARSSSHGPVLPEADQQILRDLMSDAMEEIDLQQASAPVGPQANGVLDEKSHTQEPCCSDLFLFPDESGNVSQESSPAYPSLTHHLISDAVTGVTAENDDFCILFAPKTVVQEKEEEPVIKIMVDDAIVIKDDYFSLPITRTDSSKAPLHFPIPAVRYVVKEVSLVWHLYGGKDFATAPPTSPAKSYIPHSSPSQTPTRHGRHTVCGGKGRNHDFLMEIQLSKVKFQHEVYPPCKPECESSLLEHPVSRQVFIVQDLEIRDRLATSQMNKFLYLYCSKDMPRKAHSNMLTIKALHVRPESGRSPQECCLRVSLMPLRLNIDQDALFFLKDFFTSLSTEVELLLTPDPEVTKSPGADVTCSLPRHLSTSKEPNLVVSFPGPKQASPNHRANSAEGGNGLEEDVSAEETSFSDQPVFFREFRFTAEVPIRLDYHGKHVSMDQGTLAGILIGLAQLNCSELKLKRLFYRHGLLGIDKLFSYAISEWLSDIKKNQLPGILGGVGPMHSLVQLVQGLKDLVWLPIEQYRKDGRIVRGFQRGAASFGTSTAMAALELTNRMVQTIQAAAETAYDMVSPSTLSIEPKKAKRFPHHRLAHQPVDLREGVAKAYSVVKEGITDTAQTIYETAAREHESRGVTGAVGEVLRQIPPAVVRPLIVATEATSNVLGGMRNQIRPDVRQDESQKWRHGED CF44446E4810C1EF o53850_myctu D-alanyl-D-alanine dipeptidase lpqR Rv0838 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MRLIGRLRLLMVGLVVICGACACDRVSAGRWSESPSATSWPVRPVNTTTPSGPVPPVSEAARAAGLVDVRGVVPDAAIDLRYATANNFTGTQLYPPGARCLVHESMAEGLAAAAAVLRPHGQVLVFWDCYRPHDVQVRMFDVVPNPAWVARPGKYAHSHEAGRSVDVTFASAQRQCPSVRRSGELCLADMGTDFDDFSSRATAFATQGVSAEAQANRAHLRAAMQAGGLTVYSGEWWHFDGPGAGVDRPILEVPVD psb_myctu Proteasome subunit beta Proteasome core protein PrcB Rv2110c prcB 20S proteasome beta subunit protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTWPLPDRLSINSLSGTPAVDLSSFTDFLRRQAPELLPASISGGAPLAGGDAQLPHGTTIVALKYPGGVVMAGDRRSTQGNMISGRDVRKVYITDDYTATGIAGTAAVAVEFARLYAVELEHYEKLEGVPLTFAGKINRLAIMVRGNLAAAMQGLLALPLLAGYDIHASDPQSAGRIVSFDAAGGWNIEEEGYQAVGSGSLFAKSSMKKLYSQVTDGDSGLRVAVEALYDAADDDSATGGPDLVRGIFPTAVIIDADGAVDVPESRIAELARAIIESRSGADTFGSDGGEK 3FC3FCD81231E129 mint 3FC3FCD81231E129 chp2_myctu Diacyltrehalose acyltransferase Chp2 chp2 LH57_06500 P425_01234 Rv1184c RVBD_1184c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MKRVIAGAFAVWLVGWAGGFGTAIAASEPAYPWAPGPPPSPSPVGDASTAKVVYALGGARMPGIPWYEYTNQAGSQYFPNAKHDLIDYPAGAAFSWWPTMLLPPGSHQDNMTVGVAVKDGTNSLDNAIHHGTDPAAAVGLSQGSLVLDQEQARLANDPTAPAPDKLQFTTFGDPTGRHAFGASFLARIFPPGSHIPIPFIEYTMPQQVDSQYDTNHVVTAYDGFSDFPDRPDNLLAVANAAIGAAIAHTPIGFTGPGDVPPQNIRTTVNSRGATTTTYLVPVNHLPLTLPLRYLGMSDAEVDQIDSVLQPQIDAAYARNDNWFTRPVSVDPVRGLDPLTAPGSIVEGARGLLGSPAFGG bakor_mouse Beclin 1-associated autophagy-related key regulator Atg14 D14Ertd436e Kiaa0831 Autophagy-related protein 14-like protein Atg14L protein protein mouse Mus musculus Mouse MASPSGKGSWTPEAPGFGPRALARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSQLKNKQEEFQKEVLKAMEGKRLTDQLRWKIMSCKMRIEQLKQTICKGNEEMKKNSEGLLKNKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLKSHYERLARLRRSHILELTSIIFPIDEVKTSGRDPADVSSETDSAMTSSMVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYNWVEEKKTTQGPDMEHNNPAYTISAALGYATQLVNIVSHILDINLPKKLCNSEFCGENLSKQKLTRAVRKLNANILYLCSSQHVNLDQLQPLHTLRNLMHLVSPRSEHLGRSGPFEVRADLEESMEFVDPGVAGESDASGDERVSDEETDLGTDWENLPSPRFCDIPSQPVEVSQSQSTQVSPPIASSSAGGMISSAAASVTSWFKAYTGHR DIP protein Q8CDJ3 original sequence version: 76 A221B3C03C8E2F9A o53319_myctu Rv3169 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPQMLGPLDEYPLHQLPQPIAWPGSSDRNFYDRSYFNAHDRTGNIFLITGIGYYPNLGVKDAFVLIRRADIQTAVHLSDAIDSDRLHQHVNGYRVEVVEPLRKLRIVLDETEGVAADLTWEGLFDVVQEQPHVLRSGNRVTLDAQRFAQLGTWSGRIVVDGERIAVDPATWLGSRDRSWGIRPVGEPEPAGRPADPPFEGMWWLYVPLAFDDFAVVLIIQEEPDGFRSLNDCTRIWRDGHVEQLGWPRVRIHYRSGTRIPTGATIEASTPDGAPVHFDVESKLAVPTHVGGGYGGDSDWSHGMWKGEKFVERRTYDMTDPTIIARAGFGVIDHVGRALCRDGDGNPVQGWGLFEHGALGRHDPSGFADWSTLAP lprd_myctu Putative lipoprotein LprD lprD MTCY02B10.07c Rv1343c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSTTRRRRPALIALVIIATCGCLALGWWQWTRFQSTSGTFQNLGYALQWPLFAWFCVYAYRNFVRYEETPPQPPTGGAAAEIPAGLLPERPKPAQQPPDDPVLREYNAYLAELAKDDARKQNRTTA irak3_mouse Interleukin-1 receptor-associated kinase 3 IL-1 receptor-associated kinase M Irak3 Inactive IL-1 receptor-associated kinase 3 protein protein mouse Mus musculus Mouse MAGRCGARGALSPQLLLFDLPPALLGELCGILDSCDGPLGWRGLAERLSNSWLDVRHIEKYVNQGKSGTRELLWSWAQKNKTIGDLLEVLQDMGHQRAIHLIINYGVSWTPSVQTHHELPFPSFPPEVKHACRENDPGPLEPANVTVDNVLVPEHNEKGTLQKTPISFQSILEGTKHFHKDFLIGEGEIFEVYRVDIRNQAYAVKLFKQEKKMQLKKHWKRFLSELEVLLLFRHPHILELAAYFTETEKLCLVYPYMSNGTLFDRLQCTNGTTPLSWHVRISVLIGIAKAIQYLHNTQPCAVICGNVSSANILLDDQLQPKLTDFAAAHFRPNLEQQSSTINMTGGGRKHLWYMPEEYIRQGRLSVKTDVYSFGIVIMEVLTGCKVVLDDPKHVQLRDLLMELMEKRGLDSCLSFLDRKIPPCPRNFSAKLFSLAGRCVATKAKLRPTMDEVLSSLESTQPSLYFAEDPPTSLKSFRCPSPLFLDNVPSIPVEDDENQNNHSVPPKEVLGTDRVTQKTPFECSQSEVTFLGLDRNRGNRGSEADCNVPSSSHEECWSPELVAPSQDLSPTVISLGSSWEVPGHSYGSKPMEKRCSSGLFCSEHEQSKKQ A63E010C9F29D856 sftpa_mouse Pulmonary surfactant-associated protein A Sftpa1 Sftp1 Sftp-1 Sftpa protein protein mouse Mus musculus Mouse MSLGSLAFTLFLTVVAGIKCNGTEVCAGSPGIPGTPGNHGLPGRDGRDGIKGDPGPPGPMGPPGGMPGLPGRDGLPGAPGAPGEHGDKGEPGERGLPGFPAYLDEELQTASYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIREMCTRAGGHIAAPRNPEENEAIASITKKYNTYPYLGVIEGQTPGDFHYLDGASVNYTNWYPGEPRGRGKEKCVEMYTDGKWNDKGCLQYRLAICEF In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration mint 6688BF070E3EB9AE p71619_myctu ugpB Rv2833c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MDPLNRRQFLALAAAAAGVTAGCAGMGGGGSVKSGSGPIDFWSSHPGQSSAAERELIGRFQDRFPTLSVKLIDAGKDYDEVAQKFNAALIGTDVPDVVLLDDRWWFHFALSGVLTALDDLFGQVGVDTTDYVDSLLADYEFNGRHYAVPYARSTPLFYYNKAAWQQAGLPDRGPQSWSEFDEWGPELQRVVGAGRSAHGWANADLISWTFQGPNWAFGGAYSDKWTLTLTEPATIAAGNFYRNSIHGKGYAAVANDIANEFATGILASAVASTGSLAGITASARFDFGAAPLPTGPDAAPACPTGGAGLAIPAKLSEERKVNALKFIAFVTNPTNTAYFSQQTGYLPVRKSAVDDASERHYLADNPRARVALDQLPHTRTQDYARVFLPGGDRIISAGLESIGLRGADVTKTFTNIQKRLQVILDRQIMRKLAGHG traf3_mouse TNF receptor-associated factor 3 CD40 receptor-associated factor 1 TRAFAMN Traf3 Craf1 Trafamn RING-type E3 ubiquitin transferase TRAF3 protein protein mouse Mus musculus Mouse MESSKKMDAAGTLQPNPPLKLQPDRGAGSVLVPEQGGYKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP DIP protein Q60803 original sequence version: 127 DIP protein Q60803 original sequence version: 129 DIP protein Q60803 original sequence version: 117 DIP protein Q60803 original sequence version: 121 EC282EFFF84E5A3F atg2a_mouse Autophagy-related protein 2 homolog A Atg2a Kiaa0404 protein protein mouse Mus musculus Mouse MSRWLWPWSNCVKERVCRYLLQHYLGHFFQEHLSLDQLSLDLYKGSVALRDIHLETWSVNEFLRSMESPLELVEGFVSSIEVAVPWAALLTDHCTVCVSGLQLTLQPRQGSGPGAADSQSWASCMTTSLQLAQECLREGLPEPSEPPQPLEGLEMFAQTIETVLRRIKVTFLNTVVRVEHSLGDEDRSVAVEVRVQRLEYCDEAVRDPSQAPPVDVHQPPAFLHKLLQLSGVCLYFEELPSQADPPQPPLQIGSCTGYVELMVRLKQNEAFPGPKLEVSGQLGSLHLLLTPRQLQQLQRLLSAVNLADPAGLADKLNKSRPLGAEDLWLIEQDLNQQLQAGAVAESLSLYPITNPLNLDSTDLFFSMAGLTSSVTSAVSELSVYSVDLGSSVHSNMAFHRPSTPPHSGGKMAPTPLLDTTRPDSLVKMTLGGVSLTLLQTASPSSGPSDLPTHFFAEFDAAKDGPFGSRDFSHLRPRFQRACPCSHVRLTGTAVQLSWELRTGSHSRRTSSTEVHFGQLEVLECLWPRAATEPEYTEILSFPSHSGSEASARPCAHLRHTQTIRRVLKSRSRRSTACHCHSELSLDLADFQSDVELGSLDRLAALFRQVTTPSEPPAGLLTEPPQATELQTVFRLSAPRATLRLRFPIPDLRPDRDPWAGQAVRAEQLRLELSEPQFRSELNSGPGPPAPTRLELTCSDLQGIYEDGEKPPVPCLRVSKALNPRSTEAKYFLPQVVVTLNPQSSGTQWETAYEKGRDLELSTESPCELQQPEPSPFSSKRTMYETEEMVIPGDPEEMRTFQSRTLALSRCTLDVIMPSAHIFLPSKEVYESIYNRINNDLLMWEPADLLPTSSAAARPPGSSGFKMCKSAFKLDSDSDEEDAQFFSMASGVPQTPAPEPSRRQSQSTFSTLVTVLKGRITALCEAKDETGKRLDVTHGELVLDVEQGTIFSVAQYRGQPGLGYFCLEAEKAKLYHRAAIEDYLLPTHLEVPSFAPPAQLAPTIYPSEEGVTERGTLGRKGQGPPMLSAAVRIHLDPHKNVKEFLVTVRLHKATLRHYMAPPEQSWHSQLLDFLDVLDDPVLGYLPPTVITVLHTHLFSCAVDYRPLYLPVRVLVTAETFTLSSNIVMDTSTFLLRFILDDSALYLSDKCEVESLDLRRDYVCVLDIDLLELVIKTWKGSTEGRLSQPLFELRCSNNVVHVHSCADSCALLVNLLQYLTSSGDLHPPPRPPSPTEIAGQKLSESPASLPSCLPVETALINQRDLTDALLDTERRGLQELAQSSGGPLPQASPVSVYLFPGERSGAQAPLPPPGASSHTLGSKAKEHENEEEGDGDTLDSDEFCILDAPGLGIAPRDGEPIVTQLHPGPIIVHDGHFSQPLGSTDLLRAPAHFPVPSSRVVLREVSFIWHLYGGRDFGLHPTYRARVGLTGPRVSPSRSSGPNRPQNSWRTQGGIGRQHQVLMEIQLSKVSFQHEVYPEESAIAGGLGQELDERPLSRQVLIVQELEIRDRLATSKINKFLHLHTSERLPRRTHSNMLTIKALHVAPTSSVGGPECCLRVSMMPLRLNVDQDALFFLKDFFTSLAASINPMVPGDTSEAPRETHSRPGSPQEGQSEDTETASNPPEAPGSSHSSSDQQPIYFREFRFTSEVPICLDYHGKHVTVDQVGTFMGLLIGLAQLNCSELKLKRLCCRHGLLGVDKVLCYALNEWLQDIRKNQLPGLLGGVGPMHSVVQLFQGFRDLLWLPIEQYRKDGRLIRGLQRGAASFGSSTASAALELSNRLVQAIQATAETVYDILSPASPVSRSLQDKRSSRKLRRGQQPADLREGMAKAYDAVREGILDTAQTICDVASRGHEQKGLTGAVGGVIRQLPPTVVKPIIVATEATSNVLGGMRNQILPDAHKDHALKWRLEEAQD 16742111A5534572 uvrag_mouse UV radiation resistance-associated protein Uvrag1 Uvrag protein protein mouse Mus musculus Mouse MSSCASLGGPVPLPPPGPSAALTSGAPARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHLCDNEKIFKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKEEAFQLLIEWKVYLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPCEHKGHPNAQKNLLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQRLGKEIEEKLRLTSTSNELKKESECLRLKILVLRNELERQKKALGREVAFLHKQQMALQDKGSAFSTEHGKLQLQKDSLSELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNENKDYFVCGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHISNAIPVPKRQSSTFGGADGGFSAGIPSPDKVHRKRASSENERLQYKTPPPSYNSALTQPGVAMPTSGDSERKVAPLSSSLDTSLDFSKENKKAGVDLGSSVSGDHGNSDSGQEQGEALPGHLAAVNGTALPSEQAGPAGTLLPGSCHPAPSAELCCAVEQAEEIIGLEATGFTSGDQLEALSCIPVDSAVAVECDEQVLGEFEEFSRRIYALSENVSSFRRPRRSSDK 245A411198286F33 ulk1_mouse Serine/threonine-protein kinase ULK1 Ulk1 Unc-51-like kinase 1 Serine/threonine-protein kinase Unc51.1 protein protein mouse Mus musculus Mouse MEPGRGGVETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSEDTVRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPGGRRANPSNIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPAIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASTPIKKSPPVPVPSYPSSGSGSSSSSSSASHLASPPSLGEMPQLQKTLTSPADAAGFLQGSRDSGGSSKDSCDTDDFVMVPAQFPGDLVAEAASAKPPPDSLLCSGSSLVASAGLESHGRTPSPSPTCSSSPSPSGRPGPFSSNRYGASVPIPVPTQVHNYQRIEQNLQSPTQQQTARSSAIRRSGSTTPLGFGRASPSPPSHTDGAMLARKLSLGGGRPYTPSPQVGTIPERPSWSRVPSPQGADVRVGRSPRPGSSVPEHSPRTTGLGCRLHSAPNLSDFHVVRPKLPKPPTDPLGATFSPPQTSAPQPCPGLQSCRPLRGSPKLPDFLQRSPLPPILGSPTKAGPSFDFPKTPSSQNLLTLLARQGVVMTPPRNRTLPDLSEASPFHGQQLGSGLRPAEDTRGPFGRSFSTSRITDLLLKAAFGTQASDSGSTDSLQEKPMEIAPSAGFGGTLHPGARGGGASSPAPVVFTVGSPPSGATPPQSTRTRMFSVGSSSSLGSTGSSSARHLVPGACGEAPELSAPGHCCSLADPLAANLEGAVTFEAPDLPEETLMEQEHTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWGFAEQLVLYLKVAELLSSGLQTAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDGIHGVTAERLILSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHTLTDQADIENIAKCKLCIERRLSALLSGVYA DIP protein O70405 original sequence version: 110 DIP protein O70405 original sequence version: 121 DIP protein O70405 original sequence version: 128 mint homomint Involved in axon growth. Plays an essential role in neurite extension of cerebellar granule cells 99B021985FB4E8A0 proa_myctu Gamma-glutamyl phosphate reductase proA Glutamate-5-semialdehyde dehydrogenase Glutamyl-gamma-semialdehyde dehydrogenase MTCY428.20 Rv2427c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTVPAPSQLDLRQEVHDAARRARVAARRLASLPTTVKDRALHAAADELLAHRDQILAANAEDLNAAREADTPAAMLDRLSLNPQRVDGIAAGLRQVAGLRDPVGEVLRGYTLPNGLQLRQQRVPLGVVGMIYEGRPNVTVDAFGLTLKSGNAALLRGSSSAAKSNEALVAVLRTALVGLELPADAVQLLSAADRATVTHLIQARGLVDVVIPRGGAGLIEAVVRDAQVPTIETGVGNCHVYVHQAADLDVAERILLNSKTRRPSVCNAAETLLVDAAIAETALPRLLAALQHAGVTVHLDPDEADLRREYLSLDIAVAVVDGVDAAIAHINEYGTGHTEAIVTTNLDAAQRFTEQIDAAAVMVNASTAFTDGEQFGFGAEIGISTQKLHARGPMGLPELTSTKWIAWGAGHTRPA wasp_mouse Wiskott-Aldrich syndrome protein homolog Was Wasp protein protein mouse Mus musculus Mouse MNSGPGPVGGRPGGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATTVVQLYLALPPGAEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGDDCQVGLNFADESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPINEERRGGLPPVPPHPGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPCRGGGGGGGGGGGGGGGGGGQPLRPPVVGSNKGRSGPLPPVPMGGAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPLPGAGGPPAPPPPPPPPPPPPCPGSGPAPPPLPPTPVSGGSPAPGGGRGALLDQIRQGIQLNKTPGALENSVQQPPAQQSEGLVGALMHVMQKRSRVIHSSDEGEDQTGEDEEDDEWDD DIP protein P70315 original sequence version: 114 DIP protein P70315 original sequence version: 125 9C223733C59F0C8A l7n684_myctu Rv2141c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTDETGASSDHSDDVAQVVSRLIRFDTTNSGEPGTTKGEAECARWVAEQLAEVGYQPEYVESGAPGRGNVFARLAGADSSRGALLIHGHLDVVPAEPAEWSVHPFSGAIEDGYVWGRGAVDMKDMVGMMIVVARHLRQAAIVPPRDLVFAFVADEEHGGKYGSHWLVDNRPDLFDGITEAIGEVGGFSLTVPRHDGGERRLYLIETAEKGIQWMRLTARGRAGHGSMVHDQNAVTAVCEAVARLGRHQFPLVCTDTVAQFLAVVGEETGLAFDLDSPDLAGTIDKLGPMARMLKAVLHDTANPTMLKAGYKANVVPATAEAVVDCRVLPGRRAAFEAEVDALIGPDVTREWVSDLPSYETTFDGDLVAAMNAAVLAVDPDGRTVPYMLSGGTDAKAFARLGIRCFGFSPLRLPPDLDFTSLFHGVDERVPIDGLRFGTEVLTHLLTHC mak1_myctu Maltokinase mak Maltose-1-phosphate synthase Rv0127 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTRSDTLATKLPWSDWLSRQRWYAGRNRELATVKPGVVVALRHNLDLVLVDVTYTDGATERYQVLVGWDFEPASEYGTKAAIGVADDRTGFDALYDVAGPQFLLSLIVSSAVCGTSTGEVTFTREPDVELPFAAQPRVCDAEQSNTSVIFDRRAILKVFRRVSSGINPDIELNRVLTRAGNPHVARLLGAYQFGRPNRSPTDALAYALGMVTEYEANAAEGWAMATASVRDLFAEGDLYAHEVGGDFAGESYRLGEAVASVHATLADSLGTAQATFPVDRMLARLSSTVAVVPELREYAPTIEQQFQKLAAEAITVQRVHGDLHLGQVLRTPESWLLIDFEGEPGQPLDERRAPDSPLRDVAGVLRSFEYAAYGPLVDQATDKQLAARAREWVERNRAAFCDGYAVASGIDPRDSALLLGAYELDKAVYETGYETRHRPGWLPIPLRSIARLTAS ulk2_mouse Serine/threonine-protein kinase ULK2 Ulk2 Kiaa0623 Serine/threonine-protein kinase Unc51.2 Unc-51-like kinase 2 protein protein mouse Mus musculus Mouse MEVVGDFEYCKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQVPVKKSCPVPVPVYSGPVPGSSCSSSPSCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSASNSSKNSSCDTDDFVLVPHNISSDHSYDMPMGTTARRASNEFFMCGGQCQPTVSPHSETAPIPVPTQVRNYQRIEQNLISTASSGTNPHGSPRSAVVRRSNTSPMGFLRVGSCSPVPGDTVQTGGRRLSTGSSRPYSPSPLVGTIPEQFSQCCCGHPQGHEARSRHSSGSPVPQTQAPQSLLLGARLQSAPTLTDIYQNKQKLRKQHSDPVCPSHAGAGYSYSPQPSRPGSLGTSPTKHTGSSPRNSDWFFKTPLPTIIGSPTKTTAPFKIPKTQASSNLLALVTRHGPAESQSKDGNDPRECSHCLSVQGSERHRSEQQQSKAVFGRSVSTGKLSEQQVKAPLGGHQGSTDSLNTERPMDVAPAGACGVMLALPAGTAASARAVLFTVGSPPHSATAPTCTHMVLRTRTTSVGSSSSGGSLCSASGRVCVGSPPGPGLGSSPPGAEGAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNMMLMFTECVLDLTAVRGGNPELCTSAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASLHLAKAQVKSGKLSPSMAVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSVTAEKLIYNCAVEMVQSAALDEMFQQTEDIVYRYHKAALLLEGLSKILQDPTDVENVHKYKCSIERRLSALCCSTATV DIP protein Q9QY01 original sequence version: 110 2E7DC3B0B87E9607 gln1a_myctu Glutamine synthetase glnA2 Glutamate--ammonia ligase Glutamine synthetase I alpha MTCY190.33c MTCY427.03c Rv2222c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MDRQKEFVLRTLEERDIRFVRLWFTDVLGFLKSVAIAPAELEGAFEEGIGFDGSSIEGFARVSESDTVAHPDPSTFQVLPWATSSGHHHSARMFCDITMPDGSPSWADPRHVLRRQLTKAGELGFSCYVHPEIEFFLLKPGPEDGSVPVPVDNAGYFDQAVHDSALNFRRHAIDALEFMGISVEFSHHEGAPGQQEIDLRFADALSMADNVMTFRYVIKEVALEEGARASFMPKPFGQHPGSAMHTHMSLFEGDVNAFHSADDPLQLSEVGKSFIAGILEHACEISAVTNQWVNSYKRLVQGGEAPTAASWGAANRSALVRVPMYTPHKTSSRRVEVRSPDSACNPYLTFAVLLAAGLRGVEKGYVLGPQAEDNVWDLTPEERRAMGYRELPSSLDSALRAMEASELVAEALGEHVFDFFLRNKRTEWANYRSHVTPYELRTYLSL rubic_mouse Run domain Beclin-1-interacting and cysteine-rich domain-containing protein Rubcn Kiaa0226 protein protein mouse Mus musculus Mouse MRPEGAGMDLGGGDGERLLEKSRREHWQLLGNLKTTVEGLVSANCPNVWSKYGGLERLCRDMQNILYHGLIHDQVCCRQADYWQFVKDIRWLSPHSALHVEKFISLHESDQSDTDSVSERAVAELWLQHSLQCHCLSAQLRPLLGDRQYIRKFYTETAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKQESPLLVTKSQSLTALPGSTYTPPASYAQHSYFGSSSSLQSMPQSSHSSERRSTSFSLSGPSWQPQEDRECLSPAETQTTPAPLPSDSTLAQDSPLTAQEMSDSTLTSPLEASWVSSQNDSPSDVSEGPEYLAIGNPAPHGRTASCESHSSNGESSSSHLFSSSSSQKLESAASSLGDQEEGRQSQAGSVLRRSSFSEGQTAPVASGTKKSHIRSHSDTNIASRGAAGGPRNITIIVEDPIAEGGQYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFSISESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKIRLRRQQIRTKNLLPAYRETENGSFRVTSSSSQFSSRDSTQLSESGSAEDADDLEIQDADIRRSAVSNGKSSFSQNLSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHADIYKLRIRVRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMVVPSRILRKWDFSKYYVSNFSKDLLLKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLYHMKNMFKTCRLAKELLDSFDVVPGHLTEDLHLYSLSDLTATKKGELGPRLAELTRAGAAHVERCMLCQAKGFICEFCQNEEDVIFPFELHKCRTCEECKACYHKTCFKSGRCPRCERLQARRELLAKQSLESYLSDYEEEPTEALALEATVLETT E5D8CD691C0D5184 y2280_myctu-atg14-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG14 21 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-atg14-1 2 Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG14 21 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ugpb-atg2a-1 2 Rv2833c 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-atg2a-1 2 Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-atg2a-1 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-atg2a-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 esxo-atg2a-1 2 ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2346c 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-atg2a-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 dcd-atg2a-1 2 Rv0321 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-atg2a-1 2 Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-atg2a-1 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-atg2a-1 2 Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o53319_myctu-atg2a-1 2 Rv3169 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-atg2a-1 2 Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-atg2a-2 2 Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ugpb-atg2a-2 2 Rv2833c 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-atg2a-2 2 Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-atg2a-2 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-atg2a-2 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 lprd-atg2a-1 2 Rv1343c 23 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-atg2a-2 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 prcb-atg2a-1 2 Rv2110c 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-atg2a-2 2 Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o53319_myctu-atg2a-2 2 Rv3169 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2a 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-atg2b-1 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-atg2b-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 esxo-atg2b-1 2 ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2346c 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-atg2b-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-atg2b-1 2 Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-atg2b-1 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 prcb-atg2b-1 2 Rv2110c 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-atg2b-2 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-atg2b-2 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-atg2b-2 2 Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-atg2b-2 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o53319_myctu-atg2b-1 2 Rv3169 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-atg2b-3 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-atg2b-3 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-atg2b-3 2 Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-atg2b-3 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o53319_myctu-atg2b-2 2 Rv3169 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ATG2b 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-irak4-1 2 IRAK 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-irak4-1 2 IRAK 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-irak3-1 2 Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ugpb-irak3-1 2 Rv2833c 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-irak3-1 2 Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 l7n684_myctu-irak3-1 2 Rv2141c 33 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-irak3-1 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-irak3-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 esxo-irak3-1 2 IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2346c 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-irak3-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-irak3-1 2 Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-irak3-1 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 prcb-irak3-1 2 Rv2110c 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ephb-irak3-1 2 Rv1938 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-irak3-1 2 Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell IRAK-M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-eif2ak3-1 2 Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 l7n684_myctu-eif2ak3-1 2 Rv2141c 33 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-eif2ak3-1 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-eif2ak3-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 esxo-eif2ak3-1 2 PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2346c 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-eif2ak3-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-eif2ak3-1 2 Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-eif2ak3-1 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 lpqr-eif2ak3-1 2 Rv0838 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-eif2ak3-1 2 Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o53319_myctu-eif2ak3-1 2 Rv3169 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 proa-eif2ak3-1 2 Rv2427c 31 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-eif2ak3-1 2 Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell PERK 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-rasgrp1-1 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell RasGRP 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-rasgrp1-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell RasGRP 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-rasgrp1-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell RasGRP 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-rasgrp1-1 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell RasGRP 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ugpb-relb-1 2 Rv2833c 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Relb 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-relb-1 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Relb 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-relb-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Relb 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 lprd-relb-1 2 Rv1343c 23 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Relb 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 dcd-relb-1 2 Rv0321 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Relb 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-relb-1 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Relb 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ugpb-rubcn-1 2 Rv2833c 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-rubcn-1 2 Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 l7n684_myctu-rubcn-1 2 Rv2141c 33 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-rubcn-1 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-rubcn-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 esxo-rubcn-1 2 Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2346c 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-rubcn-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 dcd-rubcn-1 2 Rv0321 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-rubcn-1 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 lpqr-rubcn-1 2 Rv0838 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 prcb-rubcn-1 2 Rv2110c 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ephb-rubcn-1 2 Rv1938 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-rubcn-1 2 Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o53319_myctu-rubcn-1 2 Rv3169 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 proa-rubcn-1 2 Rv2427c 31 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-rubcn-1 2 Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rubicon 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-socs3-1 2 Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell SOCS3 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ugpb-socs3-1 2 Rv2833c 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell SOCS3 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-socs3-1 2 Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell SOCS3 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-socs3-1 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell SOCS3 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-socs3-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell SOCS3 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-socs3-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell SOCS3 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-socs3-1 2 Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell SOCS3 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-sftpa1-1 2 SP-A 25 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ugpb-sftpa1-1 2 SP-A 25 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2833c 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-sftpa1-1 2 SP-A 25 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-sftpa1-1 2 SP-A 25 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-sftpa1-1 2 SP-A 25 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-sftpa1-1 2 SP-A 25 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o53319_myctu-sftpa1-1 2 SP-A 25 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv3169 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-traf3-1 2 Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell TRAF3 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-traf3-1 2 Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell TRAF3 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-traf3-1 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell TRAF3 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-traf3-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell TRAF3 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 esxo-traf3-1 2 TRAF3 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2346c 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-traf3-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell TRAF3 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 dcd-traf3-1 2 Rv0321 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell TRAF3 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 lpqr-traf3-1 2 Rv0838 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell TRAF3 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-traf3-1 2 Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell TRAF3 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o53319_myctu-traf3-1 2 Rv3169 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell TRAF3 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ugpb-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2833c 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 l7n684_myctu-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2141c 33 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 esxo-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2346c 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 dcd-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv0321 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 prcb-tsc2-1 2 Rv2110c 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ephb-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv1938 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o53319_myctu-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv3169 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 proa-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2427c 31 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-tsc2-1 2 TSC2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-ulk1-1 2 ULK1 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-ulk1-1 2 ULK1 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-ulk1-1 2 ULK1 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-ulk1-1 2 ULK1 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-ulk1-1 2 ULK1 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-ulk1-1 2 ULK1 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-ulk1-1 2 ULK1 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ugpb-ulk2-1 2 Rv2833c 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ULK2 35 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-ulk2-1 2 Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ULK2 35 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 mak-ulk2-1 2 Rv0127 34 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ULK2 35 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-ulk2-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ULK2 35 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-ulk2-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ULK2 35 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-ulk2-1 2 Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ULK2 35 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-ulk2-1 2 Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ULK2 35 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-ulk2-1 2 Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ULK2 35 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ugpb-uvrag-1 2 Rv2833c 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-uvrag-1 2 Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-uvrag-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 esxo-uvrag-1 2 UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rv2346c 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-uvrag-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-uvrag-1 2 Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-uvrag-1 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 prcb-uvrag-1 2 Rv2110c 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ephb-uvrag-1 2 Rv1938 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-uvrag-1 2 Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o53319_myctu-uvrag-1 2 Rv3169 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-uvrag-1 2 Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell UVRAG 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o69689_myctu-was-1 2 Rv3722c 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ugpb-was-1 2 Rv2833c 26 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 glna2-was-1 2 Rv2222c 36 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 l7n684_myctu-was-1 2 Rv2141c 33 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 y2280_myctu-was-1 2 Rv2280 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 espl-was-1 2 Rv3880c 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o07422_myctu-was-1 2 Rv0178 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 i6y946_myctu-was-1 2 Rv0925c 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 lpqr-was-1 2 Rv0838 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 ephb-was-1 2 Rv1938 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 chp2-was-1 2 Rv1184c 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 o53319_myctu-was-1 2 Rv3169 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 proa-was-1 2 Rv2427c 31 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell WASP 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST5 proa-1 1 32 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell bifc tag bifc tag bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell bifc tag bifc tag bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5e It is not explained in the paper the exact tags that have been used in the BiFC experiment.