IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural analysis of respiratory syncytial virus reveals the position of M2-1 between the matrix protein and the ribonucleoprotein complex. Structural analysis of respiratory syncytial virus reveals the position of M2-1 between the matrix protein and the ribonucleoprotein complex. J. Virol. (0022-538X) 2014 imex curation Kiss G., Holl J.M., Williams G.M., Alonas E., Vanover D., Lifland A.W., Gudheti M., Guerrero-Ferreira R.C., Nair V., Yi H., Graham B.S., Santangelo P.J., Wright E.R. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. erwrigh@emory.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions hrsva human respiratory sy pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Kiss G., Holl J.M., Williams G.M., Alonas E., Vanover D., Lifland A.W., Gudheti M., Guerrero-Ferreira R.C., Nair V., Yi H., Graham B.S., Santangelo P.J., Wright E.R. Virus - Publications including interactions involving viral proteins Isolated viral particles - "virions on glass"; before fixation, virus was centrifuged through 5um and 0.45um-pore-size filters at 5,000g. This fraction was then spun down onto poly-l-lysine (Sigma)-coated coverslips. erwrigh@emory.edu Accepted 2015-JUL-31 by PPORRAS J. Virol. (0022-538X) 2014 Only protein-protein interactions imex curation Structural analysis of respiratory syncytial virus reveals the position of M2-1 between the matrix protein and the ribonucleoprotein complex. Structural analysis of respiratory syncytial virus reveals the position of M2-1 between the matrix protein and the ribonucleoprotein complex. J. Virol. (0022-538X) 2014 imex curation Kiss G., Holl J.M., Williams G.M., Alonas E., Vanover D., Lifland A.W., Gudheti M., Guerrero-Ferreira R.C., Nair V., Yi H., Graham B.S., Santangelo P.J., Wright E.R. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. erwrigh@emory.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hep2 Homo sapiens hep2 hep2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Kiss G., Holl J.M., Williams G.M., Alonas E., Vanover D., Lifland A.W., Gudheti M., Guerrero-Ferreira R.C., Nair V., Yi H., Graham B.S., Santangelo P.J., Wright E.R. Virus - Publications including interactions involving viral proteins it is rather difficult to determine for the coloured images, what is co-localising with what... so these may well just show the co-loc. of the RNA with M and M2-1 (in Figs 8A and B), Fig 8C - must show M co-loc with M2-1; however the PLA results show they all interact/colocalise. erwrigh@emory.edu Accepted 2015-JUL-31 by PPORRAS J. Virol. (0022-538X) 2014 Only protein-protein interactions imex curation m21_hrsva Protein M2-1 Transcription antitermination factor M2-1 Vp24 M2-1 Envelope-associated 22 kDa protein protein protein hrsva human respiratory sy MSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSIDTLSEISGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITINNPKESTVSDTNDHAKNNDTT CA5B397FE2707EF9 fus_hrsva Fusion glycoprotein F0 F protein protein hrsva human respiratory sy MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN DIP protein P03420 original sequence version: 71 DIP protein P03420 original sequence version: 69 DIP protein P03420 original sequence version: 83 DIP protein P03420 original sequence version: 96 DIP protein P03420 original sequence version: 101 A4066D9DC98933AA matrx_hrsva Matrix protein M protein M protein protein hrsva human respiratory sy METYVNKLHEGSTYTAAVQYNVLEKDDDPASLTIWVPMFQSSMPADLLIKELANVNILVKQISTPKGPSLRVMINSRSAVLAQMPSKFTICANVSLDERSKLAYDVTTPCEIKACSLTCLKSKNMLTTVKDLTMKTLNPTHDIIALCEFENIVTSKKVIIPTYLRSISVRNKDLNTLENITTTEFKNAITNAKIIPYSGLLLVITVTDNKGAFKYIKPQSQFIVDLGAYLEKESIYYVTTNWKHTATRFAIKPMED 1E70706D65416BA0 f-m-2 1 5 unspecified role unspecified role neutral component neutral component human-hep2 Homo sapiens hep2 hep2 4 unspecified role unspecified role neutral component neutral component human-hep2 Homo sapiens hep2 hep2 proximity proximity close-contact colocalization neighbourhood interaction 10A f-m-3 1 3 unspecified role unspecified role neutral component neutral component human-hep2 Homo sapiens hep2 hep2 4 unspecified role unspecified role neutral component neutral component human-hep2 Homo sapiens hep2 hep2 proximity proximity close-contact colocalization neighbourhood interaction 10B f-m2_1-2 1 3 unspecified role unspecified role neutral component neutral component human-hep2 Homo sapiens hep2 hep2 5 unspecified role unspecified role neutral component neutral component human-hep2 Homo sapiens hep2 hep2 proximity proximity close-contact colocalization neighbourhood interaction 10C f-m2_1-1 2 5 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component colocalization colocalization 8 f-m-1 2 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 8 f-m-1 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 8