HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Arch. Virol. (0304-8608) 2014 imex curation Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation bovin-lb9.k Bos taurus lb9.k Bovine sarcoma cell line LB9.K anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Accepted 2014-MAY-14 by ORCHARD Arch. Virol. (0304-8608) 2014 imex curation Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Arch. Virol. (0304-8608) 2014 imex curation Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation bovin-lb9.k Bos taurus lb9.k Bovine sarcoma cell line LB9.K anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Accepted 2014-MAY-14 by ORCHARD Arch. Virol. (0304-8608) 2014 imex curation Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Arch. Virol. (0304-8608) 2014 imex curation Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Accepted 2014-MAY-14 by ORCHARD Arch. Virol. (0304-8608) 2014 imex curation Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Arch. Virol. (0304-8608) 2014 imex curation Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation bovin-lb9.k Bos taurus lb9.k Bovine sarcoma cell line LB9.K pull down pull down western blot western blot Immuno blot Immuno blot Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Accepted 2014-MAY-14 by ORCHARD Arch. Virol. (0304-8608) 2014 imex curation Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Arch. Virol. (0304-8608) 2014 imex curation Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Accepted 2014-MAY-14 by ORCHARD Arch. Virol. (0304-8608) 2014 imex curation Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). Arch. Virol. (0304-8608) 2014 imex curation Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation bovin-lb9.k Bos taurus lb9.k Bovine sarcoma cell line LB9.K confocal microscopy confocal microscopy immunostaining immunostaining Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Accepted 2014-MAY-14 by ORCHARD Arch. Virol. (0304-8608) 2014 imex curation p19711-pro_0000038033 Non-structural protein 4A protein protein bvdvn Bovine viral diarrhea virus (isolate NADL) SSAENALLVALFGYVGYQALSKRHVPMITDIYTIEDQRLEDTTHLQYAPNAIKTDGTETELKEL 2363 2426 2602329A6A524656 f1mum9_bovin ADAR protein protein bovin Bos taurus (Bovine) Bovine MDPRQGYSLNRYQARPAQGYEHSRHRHQQPERGPCRDSFQLQQIEFLKGQLPEVPLFGKQPPSLPPFLPGLWPRFPGPPARGGPLQIRGVPRGVPLRSQVLPRRFQRPFPRGHIRPWRGVDRLSSHFQGLTISQDQEQRTLELLDELGDGKATTARDLARKLQAPKKDINRVLYSLAEKGKLHQEAGSPPLWRATVPVQAQNQPSQETRAESQTPGAPSPDSSVETEGRSTPCGLEEPPEPLDMAEIKEKICDHLFNVSSSSALNLAKNIGLTKARDVNAVLIDLERQGDVYRQGTTPPIWYLTDKKRERIQIKRNKDSVPETTQAAAVLETGKTTEGPTCNSPASDASNSTVTPGKVENGQEPVVKLKLKQEATAEPVKLKPPVYDNGPSKTGYVDFENGQWATDDIPDDLNSIHAAPGEFRAIMEMPSFYSHGLPRCSPYKKLTECQLKNPISGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAMKAMTILLEEAKAKDSGRSEESYHYSSEKESEKTAESQTATPSATSFLSGKNPVTTLLECVHKLGSSCEFRLLSREGPAHDPKFQYCVAMGTHTFPTASAPSKKAAKQMAAEEAMKALQGEATSSTSSEDQPGSTNTEAFDNLESVMPNKVRRISELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGEDEKAERMGFTELPLTGSTFHDQIAMLSHRCFNALTNSFQPSLLGRKILAAIIMKKDSDDLGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNPQTAKDSIFEPAKGGEKLQIKKSVSFHLYISTAPCGDGALFDKSCSDRAVESTDSRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPVYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSVYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYEIAKNYFKKSLKDMGYGNWISKPQEEKNFYLCPV 503E10440CE7576A ns4a-adar-4 5 8 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role unspecified role unspecified role physical association physical association No figure ns4a-adar-5 3 8 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1B ns4a-adar-1 2 7 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A and 4 ns4a-adar-2 4 8 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2B ns4a-adar-3 1 8 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait physical association physical association Fig. 2C adar-ns4a-1 6 8 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 3