IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Viperin is an iron-sulfur protein that inhibits genome synthesis of tick-borne encephalitis virus via radical SAM domain activity. Viperin is an iron-sulfur protein that inhibits genome synthesis of tick-borne encephalitis virus via radical SAM domain activity. Cellular microbiology 2014 imex curation Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F., Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F. Virus - Publications including interactions involving viral proteins Dark Space 53? anna.overby@climi.umu.se,friedemann.weber@staff.uni-marburg.de Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip tag visualisation tag visualisation Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F., Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F. Virus - Publications including interactions involving viral proteins Dark Space 53? anna.overby@climi.umu.se,friedemann.weber@staff.uni-marburg.de Accepted 2017-FEB-03 AT 11:24 GMT AT 11:24 GMT by ORCHARD Cellular microbiology 2014 imex curation Viperin is an iron-sulfur protein that inhibits genome synthesis of tick-borne encephalitis virus via radical SAM domain activity. Viperin is an iron-sulfur protein that inhibits genome synthesis of tick-borne encephalitis virus via radical SAM domain activity. Cellular microbiology 2014 imex curation Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F., Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F. Virus - Publications including interactions involving viral proteins Dark Space 53? anna.overby@climi.umu.se,friedemann.weber@staff.uni-marburg.de Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F., Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F. Virus - Publications including interactions involving viral proteins Dark Space 53? Tetracycline (Tet)-inducible HEK293 cell line expressing FLAG-tagged wt viperin. anna.overby@climi.umu.se,friedemann.weber@staff.uni-marburg.de Accepted 2017-FEB-03 AT 11:24 GMT AT 11:24 GMT by ORCHARD Cellular microbiology 2014 imex curation Viperin is an iron-sulfur protein that inhibits genome synthesis of tick-borne encephalitis virus via radical SAM domain activity. Viperin is an iron-sulfur protein that inhibits genome synthesis of tick-borne encephalitis virus via radical SAM domain activity. Cellular microbiology 2014 imex curation Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F., Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F. Virus - Publications including interactions involving viral proteins Dark Space 53? anna.overby@climi.umu.se,friedemann.weber@staff.uni-marburg.de Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F., Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F. Virus - Publications including interactions involving viral proteins Dark Space 53? Cells were treated with IFN-alpha. anna.overby@climi.umu.se,friedemann.weber@staff.uni-marburg.de Accepted 2017-FEB-03 AT 11:24 GMT AT 11:24 GMT by ORCHARD Cellular microbiology 2014 imex curation rsad2_human Radical S-adenosyl methionine domain-containing protein 2 RSAD2 CIG5 Cytomegalovirus-induced gene 5 protein Viperin Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible protein protein human Homo sapiens Human MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW ED014743CE1568DF iron iron small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ciao1_human Probable cytosolic iron-sulfur protein assembly protein CIAO1 WD repeat-containing protein 39 CIAO1 WDR39 CIA1 protein protein human Homo sapiens Human MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL 63A8D8257A204FC8 56q4yaedgr-1 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait Q8WXG1:p.Trp361del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain W . Wed May 02 15:20:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp361del' Tue Jun 30 17:49:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp361del' Q8WXG1:p.Trp361Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain W A Wed May 02 19:22:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp361ala' Tue Jun 30 17:43:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp361Ala' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q8WXG1:p.[Cys83Ala;Cys87Ala;Cys90Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:52:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83ala,cys87ala,cys90ala' Tue Jun 30 18:10:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys83Ala;Cys87Ala;Cys90Ala]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6A, 7A rsad2-ciao1-1 3 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 6B rsad2-ciao1-2 1 5 unspecified role unspecified role prey prey 55Fe radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait Q8WXG1:p.Trp361Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain W A Wed May 02 15:16:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp361ala' Tue Jun 30 16:20:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp361Ala' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q8WXG1:p.[Cys83Ala;Cys87Ala;Cys90Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 18:34:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83ala,cys87ala,cys90ala' Tue Jun 30 19:40:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys83Ala;Cys87Ala;Cys90Ala]' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 7D, 8D CIAO1 depletion