HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Interaction of Hepatitis C Virus Core Protein with Janus Kinase Is Required for Efficient Production of Infectious Viruses. Interaction of Hepatitis C Virus Core Protein with Janus Kinase Is Required for Efficient Production of Infectious Viruses. Biomol Ther (Seoul) (1976-9148) 2013 imex curation Lee C. Virus - Publications including interactions involving viral proteins choongholee@dongguk.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells confocal microscopy confocal microscopy immunostaining immunostaining Lee C. Virus - Publications including interactions involving viral proteins choongholee@dongguk.edu Accepted 2013-OCT-09 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. Biomol Ther (Seoul) (1976-9148) 2013 imex curation Interaction of Hepatitis C Virus Core Protein with Janus Kinase Is Required for Efficient Production of Infectious Viruses. Interaction of Hepatitis C Virus Core Protein with Janus Kinase Is Required for Efficient Production of Infectious Viruses. Biomol Ther (Seoul) (1976-9148) 2013 imex curation Lee C. Virus - Publications including interactions involving viral proteins choongholee@dongguk.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma pull down pull down western blot western blot Immuno blot Immuno blot Lee C. Virus - Publications including interactions involving viral proteins choongholee@dongguk.edu Accepted 2013-OCT-09 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. Biomol Ther (Seoul) (1976-9148) 2013 imex curation Interaction of Hepatitis C Virus Core Protein with Janus Kinase Is Required for Efficient Production of Infectious Viruses. Interaction of Hepatitis C Virus Core Protein with Janus Kinase Is Required for Efficient Production of Infectious Viruses. Biomol Ther (Seoul) (1976-9148) 2013 imex curation Lee C. Virus - Publications including interactions involving viral proteins choongholee@dongguk.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Lee C. Virus - Publications including interactions involving viral proteins choongholee@dongguk.edu Accepted 2013-OCT-09 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. Biomol Ther (Seoul) (1976-9148) 2013 imex curation q99ib8-pro_0000045592 Core protein precursor protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV STNPKPQRKTKRNTNRRPEDVKFPGGGQIVGGVYLLPRRGPRLGVRTTRKTSERSQPRGRRQPIPKDRRSTGKAWGKPGRPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRHRSRNVGKVIDTLTCGFADLMGYIPVVGAPLSGAARAVAHGVRVLEDGVNYATGNLPGFPFSIFLLALLSCITVPVSA 2 191 15A46DE9B511782B jak1_human Tyrosine-protein kinase JAK1 JAK1 JAK1A JAK1B Janus kinase 1 protein protein human Homo sapiens Human MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHHYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK DIP protein P23458 original sequence version: 120 A2C4BE27851ACABB q99ib8-pro_0000045596 Envelope glycoprotein E2 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV GTTTVGGAVARSTNVIAGVFSHGPQQNIQLINTNGSWHINRTALNCNDSLNTGFLAALFYTNRFNSSGCPGRLSACRNIEAFRIGWGTLQYEDNVTNPEDMRPYCWHYPPKPCGVVPARSVCGPVYCFTPSPVVVGTTDRRGVPTYTWGENETDVFLLNSTRPPQGSWFGCTWMNSTGFTKTCGAPPCRTRADFNASTDLLCPTDCFRKHPDATYIKCGSGPWLTPKCLVHYPYRLWHYPCTVNFTIFKIRMYVGGVEHRLTAACNFTRGDRCDLEDRDRSQLSPLLHSTTEWAILPCTYSDLPALSTGLLHLHQNIVDVQYMYGLSPAITKYVVRWEWVVLLFLLLADARVCACLWMLILLGQAEA 384 750 D23F6BB597C72007 core-jak1-1 2 Core 4 unspecified role unspecified role bait bait Q99IB8-PRO_0000045592:p.[Gly79Ala;Trp82Ala] mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain G A certain certain sequence position certain certain certain sequence position certain W A Wed May 02 15:32:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly79ala,trp82ala' Tue Jun 30 18:12:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly79Ala;Trp82Ala]' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Jak1 5 unspecified role unspecified role prey prey physical association physical association Fig. 1C and 1D q99ib8_pr-q99ib8_p-2 3 Core 4 unspecified role unspecified role neutral component neutral component Core 4 unspecified role unspecified role neutral component neutral component self interaction self interaction Fig. 5 core-e2-2 1 E2 6 unspecified role unspecified role neutral component neutral component Core 4 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 6C