HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html The Three Dimensional Structure and Interaction Studies of HCV p7 in DHPC by Solution NMR. The Three Dimensional Structure and Interaction Studies of HCV p7 in DHPC by Solution NMR. Biochemistry (0006-2960) 2013 imex curation Cook G.A., Dawson L.A., Tian Y., Opella S.J. Virus - Publications including interactions involving viral proteins sopella@ucsd.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Cook G.A., Dawson L.A., Tian Y., Opella S.J. Virus - Publications including interactions involving viral proteins sopella@ucsd.edu Accepted 2013-DEC-12 by ORCHARD Biochemistry (0006-2960) 2013 imex curation o92972-pro_0000278748 Protease NS2 protein protein hcvj4 Hepatitis C virus genotype 1b (strain HC-J4) (HCV) LDREMAASCGGAVLVGLVFLTLSPYYKVFLTRLIWWLQYFITRAEAHMQVWVPPLNVRGGRDAIILLTCAVHPELIFDITKLLLAILGPLMVLQAGITRVPYFVRAQGLIRACMLVRKVAGGHYVQMAFMKLGALTGTYVYNHLTPLRDWAHAGLRDLAVAVEPVVFSAMETKVITWGADTAACGDIILGLPVSARRGKEIFLGPADSLEGQGWRLL 810 1026 C3709AE0C42B6A3D o92972-pro_0000278747 Viroporin p7 protein protein hcvj4 Hepatitis C virus genotype 1b (strain HC-J4) (HCV) ALENLVVLNAASVAGAHGILSFLVFFCAAWYIKGRLAPGAAYAFYGVWPLLLLLLALPPRAYA 747 809 EC3C71BE8DF17D73 5-(n,n-hexamethylene)amiloride 5-(N,N-hexamethylene)amiloride HMA small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) amantadine amantadine 1-adamantanamine 1-adamantylamine 1-aminoadamantane amantadina amantadine Amantadine amantadinum Amantidine Aminoadamantane tricyclo[3.3.1.1(3,7)]decan-1-amine tricyclo[3.3.1.1(3,7)]decan-1-ylamine tricyclo[3.3.1.1(3,7)]decane-1-amine Viregyt Virosol adamantan-1-ylamine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) DKNWSYNQZKUICI-UHFFFAOYSA-N DKNWSYNQZKUICI-UHFFFAOYSA-N n-nonyldeoxynojirimycin N-Nonyldeoxynojirimycin NN-DNJ small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p7-ns2-1 1 2 unspecified role unspecified role neutral component neutral component 15n label 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P7 3 unspecified role unspecified role neutral component neutral component 1h label tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig 7A-D Ala12 and Val15 of NS2 are required for interaction. p7-ns2-2 1 P7 3 unspecified role unspecified role neutral component neutral component O92972-PRO_0000278747:p.Trp48Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 14:40:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp48ala' Tue Jun 30 18:33:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp48Ala' 15n label 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS2 2 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Fig 7E-H amantadine-p7-1 1 Amantadine 5 unspecified role unspecified role neutral component neutral component P7 3 unspecified role unspecified role neutral component neutral component 15n label 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig 6A nn-dnj-p7-1 1 P7 3 unspecified role unspecified role neutral component neutral component 15n label 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Fig 6B hma-p7-1 1 4 unspecified role unspecified role neutral component neutral component P7 3 unspecified role unspecified role neutral component neutral component 15n label 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig 6C