UniProt UniProt http://www.uniprot.org Human DDX3 interacts with the HIV-1 Tat protein to facilitate viral mRNA translation. Human DDX3 interacts with the HIV-1 Tat protein to facilitate viral mRNA translation. PLoS ONE 2013 imex curation Lai M.C., Wang S.W., Cheng L., Tarn W.Y., Tsai S.J., Sun H.S. Virus - Publications including interactions involving viral proteins Origin of DDX3X/DDX3 according ref 1 (pubmed 16818630). However, a partial amino acid sequence given therein does not uniquely correspond to human DDX3 although the corresponding partial nucleotide sequence given here was found to be human in origin. DDX3X/DDX3 coordinates have been adopted to UniProt (which includes a cleaved initiator methionine). HIV-1 Tat and Rev proteins have been mapped to the UniProt HIV-1 reference strain. hssun@mail.ncku.edu.tw Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Lai M.C., Wang S.W., Cheng L., Tarn W.Y., Tsai S.J., Sun H.S. Virus - Publications including interactions involving viral proteins Origin of DDX3X/DDX3 according ref 1 (pubmed 16818630). DDX3X/DDX3 coordinates have been adopted to UniProt (wich includes a cleaved initiator methionine). HIV-1 Tat and Rev proteins have been mapped to the UniProt HIV-1 reference strain. hssun@mail.ncku.edu.tw Accepted 2015-MAR-05 by MGT PLoS ONE 2013 imex curation Human DDX3 interacts with the HIV-1 Tat protein to facilitate viral mRNA translation. Human DDX3 interacts with the HIV-1 Tat protein to facilitate viral mRNA translation. PLoS ONE 2013 imex curation Lai M.C., Wang S.W., Cheng L., Tarn W.Y., Tsai S.J., Sun H.S. Virus - Publications including interactions involving viral proteins Origin of DDX3X/DDX3 according ref 1 (pubmed 16818630). However, a partial amino acid sequence given therein does not uniquely correspond to human DDX3 although the corresponding partial nucleotide sequence given here was found to be human in origin. DDX3X/DDX3 coordinates have been adopted to UniProt (which includes a cleaved initiator methionine). HIV-1 Tat and Rev proteins have been mapped to the UniProt HIV-1 reference strain. hssun@mail.ncku.edu.tw Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lai M.C., Wang S.W., Cheng L., Tarn W.Y., Tsai S.J., Sun H.S. Virus - Publications including interactions involving viral proteins hssun@mail.ncku.edu.tw Accepted 2015-MAR-05 by MGT PLoS ONE 2013 imex curation Human DDX3 interacts with the HIV-1 Tat protein to facilitate viral mRNA translation. Human DDX3 interacts with the HIV-1 Tat protein to facilitate viral mRNA translation. PLoS ONE 2013 imex curation Lai M.C., Wang S.W., Cheng L., Tarn W.Y., Tsai S.J., Sun H.S. Virus - Publications including interactions involving viral proteins Origin of DDX3X/DDX3 according ref 1 (pubmed 16818630). However, a partial amino acid sequence given therein does not uniquely correspond to human DDX3 although the corresponding partial nucleotide sequence given here was found to be human in origin. DDX3X/DDX3 coordinates have been adopted to UniProt (which includes a cleaved initiator methionine). HIV-1 Tat and Rev proteins have been mapped to the UniProt HIV-1 reference strain. hssun@mail.ncku.edu.tw Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lai M.C., Wang S.W., Cheng L., Tarn W.Y., Tsai S.J., Sun H.S. Virus - Publications including interactions involving viral proteins Origin of DDX3X/DDX3 according ref 1 (pubmed 16818630). DDX3X/DDX3 coordinates have been adopted to UniProt (wich includes a cleaved initiator methionine). HIV-1 Tat and Rev proteins have been mapped to the UniProt HIV-1 reference strain. hssun@mail.ncku.edu.tw Accepted 2015-FEB-26 by MGT PLoS ONE 2013 imex curation Human DDX3 interacts with the HIV-1 Tat protein to facilitate viral mRNA translation. Human DDX3 interacts with the HIV-1 Tat protein to facilitate viral mRNA translation. PLoS ONE 2013 imex curation Lai M.C., Wang S.W., Cheng L., Tarn W.Y., Tsai S.J., Sun H.S. Virus - Publications including interactions involving viral proteins Origin of DDX3X/DDX3 according ref 1 (pubmed 16818630). However, a partial amino acid sequence given therein does not uniquely correspond to human DDX3 although the corresponding partial nucleotide sequence given here was found to be human in origin. DDX3X/DDX3 coordinates have been adopted to UniProt (which includes a cleaved initiator methionine). HIV-1 Tat and Rev proteins have been mapped to the UniProt HIV-1 reference strain. hssun@mail.ncku.edu.tw Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lai M.C., Wang S.W., Cheng L., Tarn W.Y., Tsai S.J., Sun H.S. Virus - Publications including interactions involving viral proteins Origin of DDX3X/DDX3 according ref 1 (pubmed 16818630). DDX3X/DDX3 coordinates have been adopted to UniProt (wich includes a cleaved initiator methionine). HIV-1 Tat and Rev proteins have been mapped to the UniProt HIV-1 reference strain. hssun@mail.ncku.edu.tw Accepted 2015-MAR-05 by MGT PLoS ONE 2013 imex curation rev_hv1h2 Protein Rev rev ART/TRS Anti-repression transactivator Regulator of expression of viral proteins protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE DIP protein P04618 original sequence version: 105 DIP protein P04618 original sequence version: 107 4BCF5059C9A7F3B2 ddx3x_human ATP-dependent RNA helicase DDX3X DDX3X DBX DDX3 DEAD box protein 3, X-chromosomal Helicase-like protein 2 DEAD box, X isoform CAP-Rf protein protein human Homo sapiens Human MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN DIP protein O00571 original sequence version: 116 DIP protein O00571 original sequence version: 123 7074D2B8A6EBBF09 tat_hv1h2 Protein Tat tat Transactivating regulatory protein protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE 4DDC56D979769115 4DDC56D979769115 ddx3x-tat-1 2 7 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 5A and C ddx3x-rev-1 2 5 unspecified role unspecified role unspecified role unspecified role n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) physical association physical association 5B ddx3x-tat-2 4 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5D tat-ddx3x 3 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 6 unspecified role unspecified role prey prey physical association physical association 5E ddx3x-tat-3 1 7 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection 6 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 6A