HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core. Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core. J. Biol. Chem. (0021-9258) 2013 imex curation Camus G., Herker E., Modi A.A., Haas J.T., Ramage H.R., Farese R.V., Ott M. Virus - Publications including interactions involving viral proteins mott@gladstone.ucsf.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Camus G., Herker E., Modi A.A., Haas J.T., Ramage H.R., Farese R.V., Ott M. Virus - Publications including interactions involving viral proteins mott@gladstone.ucsf.edu Accepted 2013-SEP-18 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2013 imex curation Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core. Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core. J. Biol. Chem. (0021-9258) 2013 imex curation Camus G., Herker E., Modi A.A., Haas J.T., Ramage H.R., Farese R.V., Ott M. Virus - Publications including interactions involving viral proteins mott@gladstone.ucsf.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Camus G., Herker E., Modi A.A., Haas J.T., Ramage H.R., Farese R.V., Ott M. Virus - Publications including interactions involving viral proteins mott@gladstone.ucsf.edu Accepted 2013-SEP-18 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2013 imex curation Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core. Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core. J. Biol. Chem. (0021-9258) 2013 imex curation Camus G., Herker E., Modi A.A., Haas J.T., Ramage H.R., Farese R.V., Ott M. Virus - Publications including interactions involving viral proteins mott@gladstone.ucsf.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Camus G., Herker E., Modi A.A., Haas J.T., Ramage H.R., Farese R.V., Ott M. Virus - Publications including interactions involving viral proteins mott@gladstone.ucsf.edu Accepted 2013-SEP-18 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2013 imex curation Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core. Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core. J. Biol. Chem. (0021-9258) 2013 imex curation Camus G., Herker E., Modi A.A., Haas J.T., Ramage H.R., Farese R.V., Ott M. Virus - Publications including interactions involving viral proteins mott@gladstone.ucsf.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Camus G., Herker E., Modi A.A., Haas J.T., Ramage H.R., Farese R.V., Ott M. Virus - Publications including interactions involving viral proteins mott@gladstone.ucsf.edu Accepted 2013-SEP-18 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2013 imex curation Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core. Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core. J. Biol. Chem. (0021-9258) 2013 imex curation Camus G., Herker E., Modi A.A., Haas J.T., Ramage H.R., Farese R.V., Ott M. Virus - Publications including interactions involving viral proteins mott@gladstone.ucsf.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Camus G., Herker E., Modi A.A., Haas J.T., Ramage H.R., Farese R.V., Ott M. Virus - Publications including interactions involving viral proteins mott@gladstone.ucsf.edu Accepted 2013-SEP-18 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2013 imex curation q99ib8-pro_0000045602 Non-structural protein 5A protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV SGSWLRDVWDWVCTILTDFKNWLTSKLFPKLPGLPFISCQKGYKGVWAGTGIMTTRCPCGANISGNVRLGSMRITGPKTCMNTWQGTFPINCYTEGQCAPKPPTNYKTAIWRVAASEYAEVTQHGSYSYVTGLTTDNLKIPCQLPSPEFFSWVDGVQIHRFAPTPKPFFRDEVSFCVGLNSYAVGSQLPCEPEPDADVLRSMLTDPPHITAETAARRLARGSPPSEASSSVSQLSAPSLRATCTTHSNTYDVDMVDANLLMEGGVAQTEPESRVPVLDFLEPMAEEESDLEPSIPSECMLPRSGFPRALPAWARPDYNPPLVESWRRPDYQPPTVAGCALPPPKKAPTPPPRRRRTVGLSESTISEALQQLAIKTFGQPPSSGDAGSSTGAGAAESGGPTSPGEPAPSETGSASSMPPLEGEPGDPDLESDQVELQPPPQGGGVAPGSGSGSWSTCSEEDDTTVCC 1977 2442 0BDEA498491643D8 dgat1_human Diacylglycerol O-acyltransferase 1 DGAT1 AGRP1 DGAT ACAT-related gene product 1 Diglyceride acyltransferase Acyl-CoA retinol O-fatty-acyltransferase protein protein human Homo sapiens Human MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVGSGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA 6574D5DBF15D6171 q99ib8-pro_0000045592 Core protein precursor protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV STNPKPQRKTKRNTNRRPEDVKFPGGGQIVGGVYLLPRRGPRLGVRTTRKTSERSQPRGRRQPIPKDRRSTGKAWGKPGRPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRHRSRNVGKVIDTLTCGFADLMGYIPVVGAPLSGAARAVAHGVRVLEDGVNYATGNLPGFPFSIFLLALLSCITVPVSA 2 191 15A46DE9B511782B p27958-pro_0000037576 Non-structural protein 5A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SGSWLRDIWDWICEVLSDFKTWLKAKLMPQLPGIPFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCKNMWSGTFFINAYTTGPCTPLPAPNYKFALWRVSAEEYVEIRRVGDFHYVSGMTTDNLKCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLHEYPVGSQLPCEPEPDVAVLTSMLTDPSHITAEAAGRRLARGSPPSMASSSASQLSAPSLKATCTANHDSPDAELIEANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREVSVPAEILRKSRRFAPALPVWARPDYNPLLVETWKKPDYEPPVVHGCPLPPPRSPPVPPPRKKRTVVLTESTLPTALAELATKSFGSSSTSGITGDNTTTSSEPAPSGCPPDSDVESYSSMPPLEGEPGDPDLSDGSWSTVSSGADTEDVVCC 1973 2420 106ED331CF52DACA dgat1_mouse Diacylglycerol O-acyltransferase 1 Dgat1 Dgat Acyl-CoA retinol O-fatty-acyltransferase Diglyceride acyltransferase protein protein mouse Mus musculus Mouse MGDRGGAGSSRRRRTGSRVSVQGGSGPKVEEDEVRDAAVSPDLGAGGDAPAPAPAPAHTRDKDGRTSVGDGYWDLRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCVIIASNIFVVAAFQIEKRLAVGALTEQMGLLLHVVNLATIICFPAAVALLVESITPVGSVFALASYSIMFLKLYSYRDVNLWCRQRRVKAKAVSTGKKVSGAAAQQAVSYPDNLTYRDLYYFIFAPTLCYELNFPRSPRIRKRFLLRRVLEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWFFHSCLNAVAELLQFGDREFYRDWWNAESVTYFWQNWNIPVHKWCIRHFYKPMLRHGSSKWVARTGVFLTSAFFHEYLVSVPLRMFRLWAFTAMMAQVPLAWIVGRFFQGNYGNAAVWVTLIIGQPVAVLMYVHDYYVLNYDAPVGV E7B0DD6DDCF1EC2B dgat1-ns5a-1 2 NS5A 6 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait physical association physical association Fig. 1A core-ns5a-1 4 Core 8 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5A 9 unspecified role unspecified role prey prey gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association FIg. 2A q99ib8_pro-dgat1-1 4 DGAT1 10 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Core 8 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5A 9 unspecified role unspecified role prey prey gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association FIg. 2A and 2B Tandem immunoprecipitations were performed with α-FLAG M2 affinity gel and α-HA antibody-conjugated agarose. α-FLAG M2 affinity gel was eluted with FLAG peptide, and the eluates were incubated with α-HA antibody-conjugated agarose. dgat1-ns5a-3 3 DGAT1 10 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5A 6 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 6D DGAT1 mutant (his426ala) interacted with NS5A with similar affinity to wild-type but suppressed NS5A translocation to lipid droplets. dgat1-core-1 3 Core 8 unspecified role unspecified role neutral component neutral component DGAT1 10 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 6E dgat1-p27958_pro-1 5 NS5A 9 unspecified role unspecified role prey prey gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined DGAT1 10 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1B, 6A and 6B core-ns5a-2 4 Core 8 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5A 9 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association FIg. 2A dgat1-core-2 2 7 unspecified role unspecified role bait bait Core 8 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1A dgat1-q99ib8_pro-1 1 7 unspecified role unspecified role bait bait NS5A 6 unspecified role unspecified role prey prey physical association physical association Fig. 1C