HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. PLoS Pathog. (1553-7366) 2012 imex curation Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins seinav@stanford.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells confocal microscopy confocal microscopy immunostaining immunostaining Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins seinav@stanford.edu Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. PLoS Pathog. (1553-7366) 2012 imex curation Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. PLoS Pathog. (1553-7366) 2012 imex curation Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins seinav@stanford.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells split luciferase complementation split luciferase complementation tag luciferase tag visualisation by luciferase assay tag luciferase Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins seinav@stanford.edu Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. PLoS Pathog. (1553-7366) 2012 imex curation Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. PLoS Pathog. (1553-7366) 2012 imex curation Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins seinav@stanford.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins Should I also capture data in 7B? - no, you can curate small molecule interactions if you wish, but this appears to be whole cell data so need not be added. seinav@stanford.edu Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. PLoS Pathog. (1553-7366) 2012 imex curation Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. PLoS Pathog. (1553-7366) 2012 imex curation Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins seinav@stanford.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity techniques affinity technology affinity techniques tag fluorescence tag visualisation by fluorescence tag fluorescence Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins seinav@stanford.edu Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. PLoS Pathog. (1553-7366) 2012 imex curation p27958-pro_0000037566 Core protein precursor protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASA 2 191 7C9059C0D1D2732E q99ib8-pro_0000045596 Envelope glycoprotein E2 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV GTTTVGGAVARSTNVIAGVFSHGPQQNIQLINTNGSWHINRTALNCNDSLNTGFLAALFYTNRFNSSGCPGRLSACRNIEAFRIGWGTLQYEDNVTNPEDMRPYCWHYPPKPCGVVPARSVCGPVYCFTPSPVVVGTTDRRGVPTYTWGENETDVFLLNSTRPPQGSWFGCTWMNSTGFTKTCGAPPCRTRADFNASTDLLCPTDCFRKHPDATYIKCGSGPWLTPKCLVHYPYRLWHYPCTVNFTIFKIRMYVGGVEHRLTAACNFTRGDRCDLEDRDRSQLSPLLHSTTEWAILPCTYSDLPALSTGLLHLHQNIVDVQYMYGLSPAITKYVVRWEWVVLLFLLLADARVCACLWMLILLGQAEA 384 750 D23F6BB597C72007 q99ib8-pro_0000045592 Core protein precursor protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV STNPKPQRKTKRNTNRRPEDVKFPGGGQIVGGVYLLPRRGPRLGVRTTRKTSERSQPRGRRQPIPKDRRSTGKAWGKPGRPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRHRSRNVGKVIDTLTCGFADLMGYIPVVGAPLSGAARAVAHGVRVLEDGVNYATGNLPGFPFSIFLLALLSCITVPVSA 2 191 15A46DE9B511782B ap2m1_human AP-2 complex subunit mu Adaptor protein complex AP-2 subunit mu AP-2 mu chain AP2M1 CLAPM1 KIAA0109 Adaptin-mu2 Plasma membrane adaptor AP-2 50 kDa protein HA2 50 kDa subunit Clathrin coat assembly protein AP50 Clathrin coat-associated protein AP50 Clathrin assembly protein complex 2 mu medium chain Adaptor-related protein complex 2 subunit mu protein protein human Homo sapiens Human MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 82803219BA279954 core-ap2m1-1 4 AP2M1 8 unspecified role unspecified role bait bait fitc labelled fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Core 7 unspecified role unspecified role prey prey t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cy3 label cy3 label cy3 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1E and 1F ap2m1-core-1 3 AP2M1 8 unspecified role unspecified role bait bait Core 5 unspecified role unspecified role prey prey substitution of YXXW motif (W is a bulky hydrophobic residue) with YTPL and YRRL sequences increased the rate of core-AP2M1 binding. physical association physical association Fig. 2D Calyculin A (an inhibitor of AP2M1 dephosphorylation) ap2m1-core-2 1 AP2M1 8 unspecified role unspecified role neutral component neutral component Core 5 unspecified role unspecified role neutral component neutral component P27958-PRO_0000037566:p.Tyr135Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 20:18:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr135ala' Tue Jun 30 18:15:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr135Ala' substitution of YXXW motif (W is a bulky hydrophobic residue) with YTPL and YRRL sequences increased the rate of core-AP2M1 binding. colocalization colocalization Fig. 2E, 5D, 5F, 5I and 5J core-e2-3 1 E2 6 unspecified role unspecified role neutral component neutral component Core 7 unspecified role unspecified role neutral component neutral component Q99IB8-PRO_0000045592:p.Tyr135Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:41:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr135ala' Tue Jun 30 17:02:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr135Ala' substitution of YXXW motif (W is a bulky hydrophobic residue) with YTPL and YRRL sequences increased the rate of core-AP2M1 binding. colocalization colocalization Fig. 5O and 5P p27958_core-1 3 Core 5 unspecified role unspecified role bait bait substitution of YXXW motif (W is a bulky hydrophobic residue) with YTPL and YRRL sequences increased the rate of core-AP2M1 binding. AP2M1 8 unspecified role unspecified role prey prey physical association physical association Fig. 2D core-ap2m1-2 2 Core 5 unspecified role unspecified role bait bait P27958-PRO_0000037566:p.Val139Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain V A Wed May 02 15:54:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val139ala' Tue Jun 30 17:55:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val139Ala' P27958-PRO_0000037566:p.Ile136Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I A Wed May 02 15:22:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile136ala' Tue Jun 30 16:15:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile136Ala' renilla-c tag renilla-c renilla-c undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined substitution of YXXW motif (W is a bulky hydrophobic residue) with YTPL and YRRL sequences increased the rate of core-AP2M1 binding. AP2M1 8 unspecified role unspecified role prey prey Q96CW1:p.Thr156Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 19:13:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr156ala' Tue Jun 30 19:05:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr156Ala' renilla-n renilla-n renilla-n undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2B, 3A, 6B