IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Severe acute respiratory syndrome coronavirus accessory proteins 6 and 9b interact in vivo. Severe acute respiratory syndrome coronavirus accessory proteins 6 and 9b interact in vivo. Virus research 2012 imex curation Calvo E., DeDiego ML., García P., López JA., Pérez-Breña P., Falcón A. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus afalcon@cnb.csic.es Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Calvo E., DeDiego ML., García P., López JA., Pérez-Breña P., Falcón A. Virus - Publications including interactions involving viral proteins afalcon@cnb.csic.es Accepted 2020-JUN-19 AT 16:27 BST AT 16:27 BST by ORCHARD Virus research 2012 Only protein-protein interactions imex curation imex curation Severe acute respiratory syndrome coronavirus accessory proteins 6 and 9b interact in vivo. Severe acute respiratory syndrome coronavirus accessory proteins 6 and 9b interact in vivo. Virus research 2012 imex curation Calvo E., DeDiego ML., García P., López JA., Pérez-Breña P., Falcón A. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus afalcon@cnb.csic.es Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Calvo E., DeDiego ML., García P., López JA., Pérez-Breña P., Falcón A. Virus - Publications including interactions involving viral proteins afalcon@cnb.csic.es Accepted 2020-JUN-19 AT 16:27 BST AT 16:27 BST by ORCHARD Virus research 2012 Only protein-protein interactions imex curation imex curation q19qw5_sars Accessory protein 6 ORF6 sars6 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP 70C9150941C759BF orf9b_sars ORF9b protein Protein 9b 9b Accessory protein 9b ORF-9b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 5166F22872915FCB orf6-orf9b_cvhsa-1 2 3 unspecified role unspecified role bait bait partially purified partially purified infection infection 4 unspecified role unspecified role prey prey infection infection physical association physical association Figs. 3, 4 orf6-orf9b_cvhsa-2 1 3 unspecified role unspecified role neutral component neutral component infection infection 4 unspecified role unspecified role neutral component neutral component infection infection colocalization colocalization Fig. 5