IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Virus-induced necrosis is a consequence of direct protein-protein interaction between a viral RNA-silencing suppressor and a host catalase. Virus-induced necrosis is a consequence of direct protein-protein interaction between a viral RNA-silencing suppressor and a host catalase. Plant Physiol. (0032-0889) 2011 imex curation Inaba J., Kim B.M., Shimura H., Masuta C. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. Protein 2b from strain HL (Lily) has been randomly assigned to one of the 84 trembl entries that have the same length stated by the authors, since the reference proteome 2b protein has a shorter length and there is no specific proteome for this particular strain. Protein 2b from the Y strain has been assigned to the reference proteome swissprot entry since no length is specified for this one. The authors were contacted concerning the sequences used for both proteins but did not reply. masuta@res.agr.hokudai.ac.jp 02-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Inaba J., Kim B.M., Shimura H., Masuta C. Virus - Publications including interactions involving viral proteins Protein 2b from strain HL (Lily) has been randomly assigned to one of the 84 trembl entries that have the same length stated by the authors, since the reference proteome 2b protein has a shorter length and there is no specific proteome for this particular strain. Protein 2b from the Y strain has been assigned to the reference proteome swissprot entry since no length is specified for this one. The authors were contacted concerning the sequences used for both proteins but did not reply. masuta@res.agr.hokudai.ac.jp Accepted 2014-MAR-18 by MGT Arabidopsis thaliana cDNA library. Plant Physiol. (0032-0889) 2011 Only protein-protein interactions imex curation Virus-induced necrosis is a consequence of direct protein-protein interaction between a viral RNA-silencing suppressor and a host catalase. Virus-induced necrosis is a consequence of direct protein-protein interaction between a viral RNA-silencing suppressor and a host catalase. Plant Physiol. (0032-0889) 2011 imex curation Inaba J., Kim B.M., Shimura H., Masuta C. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. Protein 2b from strain HL (Lily) has been randomly assigned to one of the 84 trembl entries that have the same length stated by the authors, since the reference proteome 2b protein has a shorter length and there is no specific proteome for this particular strain. Protein 2b from the Y strain has been assigned to the reference proteome swissprot entry since no length is specified for this one. The authors were contacted concerning the sequences used for both proteins but did not reply. masuta@res.agr.hokudai.ac.jp 02-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Inaba J., Kim B.M., Shimura H., Masuta C. Virus - Publications including interactions involving viral proteins Protein 2b from strain HL (Lily) has been randomly assigned to one of the 84 trembl entries that have the same length stated by the authors, since the reference proteome 2b protein has a shorter length and there is no specific proteome for this particular strain. Protein 2b from the Y strain has been assigned to the reference proteome swissprot entry since no length is specified for this one. The authors were contacted concerning the sequences used for both proteins but did not reply. masuta@res.agr.hokudai.ac.jp Accepted 2014-MAR-18 by MGT Plant Physiol. (0032-0889) 2011 Only protein-protein interactions imex curation Virus-induced necrosis is a consequence of direct protein-protein interaction between a viral RNA-silencing suppressor and a host catalase. Virus-induced necrosis is a consequence of direct protein-protein interaction between a viral RNA-silencing suppressor and a host catalase. Plant Physiol. (0032-0889) 2011 imex curation Inaba J., Kim B.M., Shimura H., Masuta C. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. Protein 2b from strain HL (Lily) has been randomly assigned to one of the 84 trembl entries that have the same length stated by the authors, since the reference proteome 2b protein has a shorter length and there is no specific proteome for this particular strain. Protein 2b from the Y strain has been assigned to the reference proteome swissprot entry since no length is specified for this one. The authors were contacted concerning the sequences used for both proteins but did not reply. masuta@res.agr.hokudai.ac.jp 02-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Inaba J., Kim B.M., Shimura H., Masuta C. Virus - Publications including interactions involving viral proteins Protein 2b from strain HL (Lily) has been randomly assigned to one of the 84 trembl entries that have the same length stated by the authors, since the reference proteome 2b protein has a shorter length and there is no specific proteome for this particular strain. Protein 2b from the Y strain has been assigned to the reference proteome swissprot entry since no length is specified for this one. The authors were contacted concerning the sequences used for both proteins but did not reply. masuta@res.agr.hokudai.ac.jp Accepted 2014-MAR-18 by MGT Plant Physiol. (0032-0889) 2011 Only protein-protein interactions imex curation 2b_cmvfn Suppressor of silencing 2b Protein 2b ORF2b protein protein cmvfn Cucumber mosaic virus (strain FNY) MELNVGAMTNVELQLARMVEAKKQRRRSHKQNRRERGHKSPSERARSNLRLFRFLPFYQVDGSELTGSCRHVNVAELPESEASRLELSAEDHDFDDTDWFAGNEWAEGAF 59690777E7D64128 cata3_arath Catalase-3 CAT3 F2D10.40 F5M15.5 At1g20620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLPESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFHWKPTCGIKNLTDEEAKVVGGANHSHATKDLHDAIASGNYPEWKLFIQTMDPADEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI 7322B111CFEBF37E c1kkl7_9brom protein protein cucumber mosaic cucumovirus Cucumber mosaic virus MELNEGAMTNVELQLARMVEAKRQRRRSHKKNRRERCYKSPSERARSNLRLFRFLPFYQVDGSELIEMYCHVNVAELSESEAPCFTLPAEDDHDFDDTDWLAGNEWAEGAF 14122C2D7B0FEC13 c1kkl7-cat3 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey fragment sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association no figure Protein 2b from cucumber mosaic virus, strain HL (Lily) was used here. c1kkl7-cat3-1 2 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association 2, 3 Protein 2b from cucumber mosaic virus, strain HL (Lily) was used here. c1kkl7-cat3-5 3 6 unspecified role unspecified role neutral component neutral component no nuclear localization signal fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 10b Protein 2b from cucumber mosaic virus, strain HL (Lily) was used here. Neither HL2b-DeltaNLS nor CAT3 was localized in the nucleus. c1kkl7-cat3-6 3 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 6a Protein 2b from cucumber mosaic virus, strain HL (Lily) was used here. 2b-cat3 3 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction S2a Protein 2b from cucumber mosaic virus, strain Y was used here.