HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Hepatitis C virus NS2 protein serves as a scaffold for virus assembly by interacting with both structural and nonstructural proteins. Hepatitis C virus NS2 protein serves as a scaffold for virus assembly by interacting with both structural and nonstructural proteins. J. Virol. (0022-538X) 2011 imex curation Ma Y., Anantpadma M., Timpe J.M., Shanmugam S., Singh S.M., Lemon S.M., Yi M. Virus - Publications including interactions involving viral proteins miyi@utmb.edu 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Ma Y., Anantpadma M., Timpe J.M., Shanmugam S., Singh S.M., Lemon S.M., Yi M. Virus - Publications including interactions involving viral proteins miyi@utmb.edu Accepted 2013-AUG-30 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2011 imex curation Hepatitis C virus NS2 protein serves as a scaffold for virus assembly by interacting with both structural and nonstructural proteins. Hepatitis C virus NS2 protein serves as a scaffold for virus assembly by interacting with both structural and nonstructural proteins. J. Virol. (0022-538X) 2011 imex curation Ma Y., Anantpadma M., Timpe J.M., Shanmugam S., Singh S.M., Lemon S.M., Yi M. Virus - Publications including interactions involving viral proteins miyi@utmb.edu 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ma Y., Anantpadma M., Timpe J.M., Shanmugam S., Singh S.M., Lemon S.M., Yi M. Virus - Publications including interactions involving viral proteins miyi@utmb.edu Accepted 2013-AUG-30 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2011 imex curation p27958-pro_0000037571 Viroporin p7 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) ALENLVILNAASLAGTHGLVSFLVFFCFAWYLKGRWVPGAVYALYGMWPLLLLLLALPQRAYA 747 809 E2520CB89A549691 q99ib8-pro_0000045599 Serine protease/helicase NS3 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV APITAYAQQTRGLLGAIVVSMTGRDRTEQAGEVQILSTVSQSFLGTTISGVLWTVYHGAGNKTLAGLRGPVTQMYSSAEGDLVGWPSPPGTKSLEPCKCGAVDLYLVTRNADVIPARRRGDKRGALLSPRPISTLKGSSGGPVLCPRGHVVGLFRAAVCSRGVAKSIDFIPVETLDVVTRSPTFSDNSTPPAVPQTYQVGYLHAPTGSGKSTKVPVAYAAQGYKVLVLNPSVAATLGFGAYLSKAHGINPNIRTGVRTVMTGEAITYSTYGKFLADGGCASGAYDIIICDECHAVDATSILGIGTVLDQAETAGVRLTVLATATPPGSVTTPHPDIEEVGLGREGEIPFYGRAIPLSCIKGGRHLIFCHSKKKCDELAAALRGMGLNAVAYYRGLDVSIIPAQGDVVVVATDALMTGYTGDFDSVIDCNVAVTQAVDFSLDPTFTITTQTVPQDAVSRSQRRGRTGRGRQGTYRYVSTGERASGMFDSVVLCECYDAGAAWYDLTPAETTVRLRAYFNTPGLPVCQDHLEFWEAVFTGLTHIDAHFLSQTKQAGENFAYLVAYQATVCARAKAPPPSWDAMWKCLARLKPTLAGPTPLLYRLGPITNEVTLTHPGTKYIATCMQADLEVMT 1031 1661 B6CEB07928DC653D p27958-pro_0000037572 Protease NS2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) LDTEVAASCGGVVLVGLMALTLSPYYKRYISWCMWWLQYFLTRVEAQLHVWVPPLNVRGGRDAVILLTCVVHPALVFDITKLLLAIFGPLWILQASLLKVPYFVRVQGLLRICALARKIAGGHYVQMAIIKLGALTGTCVYNHLAPLRDWAHNGLRDLAVAVEPVVFSRMETKLITWGADTAACGDIINGLPVSARRGQEILLGPADGMVSKGWRLL 810 1026 2036555B07778591 p27958-pro_0000037570 Envelope glycoprotein E2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) ETHVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCRRLTDFAQGWGPISYANGSGLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCPTDCFRKYPEATYSRCGSGPRITPRCMVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLPALSTGLIHLHQNIVDVQYLYGVGSSIASWAIKWEYVVLLFLLLADARVCSCLWMMLLISQAEA 384 746 9243E2103B6CCA2D p27958-pro_0000037569 Envelope glycoprotein E1 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) YQVRNSSGLYHVTNDCPNSSVVYEAADAILHTPGCVPCVREGNASRCWVAVTPTVATRDGKLPTTQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRHHWTTQDCNCSIYPGHITGHRMAWNMMMNWSPTAALVVAQLLRIPQAIMDMIAGAHWGVLAGIKYFSMVGNWAKVLVVLLLFAGVDA 192 383 62EDCA90D2CEBCE8 q99ib8-pro_0000045602 Non-structural protein 5A protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV SGSWLRDVWDWVCTILTDFKNWLTSKLFPKLPGLPFISCQKGYKGVWAGTGIMTTRCPCGANISGNVRLGSMRITGPKTCMNTWQGTFPINCYTEGQCAPKPPTNYKTAIWRVAASEYAEVTQHGSYSYVTGLTTDNLKIPCQLPSPEFFSWVDGVQIHRFAPTPKPFFRDEVSFCVGLNSYAVGSQLPCEPEPDADVLRSMLTDPPHITAETAARRLARGSPPSEASSSVSQLSAPSLRATCTTHSNTYDVDMVDANLLMEGGVAQTEPESRVPVLDFLEPMAEEESDLEPSIPSECMLPRSGFPRALPAWARPDYNPPLVESWRRPDYQPPTVAGCALPPPKKAPTPPPRRRRTVGLSESTISEALQQLAIKTFGQPPSSGDAGSSTGAGAAESGGPTSPGEPAPSETGSASSMPPLEGEPGDPDLESDQVELQPPPQGGGVAPGSGSGSWSTCSEEDDTTVCC 1977 2442 0BDEA498491643D8 ns2-ns3-8 2 NS2 5 unspecified role unspecified role bait bait tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS3 4 unspecified role unspecified role prey prey physical association physical association Fig.2, 3B and 3C, and 4C KRAA mutation (lys33_arg35ala) in P7 decease interaction rate ns2-e1-2 2 NS2 5 unspecified role unspecified role bait bait tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined E1 7 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3A KRAA mutation (lys33_arg35ala) in P7 decease interaction rate ns2-e2-p7-1 2 P7 3 unspecified role unspecified role prey prey P27958-PRO_0000037571:p.Lys33Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:20:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys33ala' Tue Jun 30 17:28:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys33Ala' P27958-PRO_0000037571:p.Arg35Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:51:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg35ala' Tue Jun 30 16:17:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg35Ala' NS2 5 unspecified role unspecified role bait bait tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined E2 6 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3B, 4C ns2-ns5a-4 2 NS2 5 unspecified role unspecified role prey prey NS5A 8 unspecified role unspecified role bait bait yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A and C KRAA mutation (lys33_arg35ala) in P7 decease interaction rate ns2-p7-4 2 NS2 5 unspecified role unspecified role prey prey P7 3 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P27958-PRO_0000037571:p.Lys33Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 14:58:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys33ala' Tue Jun 30 16:08:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys33Ala' P27958-PRO_0000037571:p.Arg35Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:31:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg35ala' Tue Jun 30 18:04:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg35Ala' physical association physical association Fig. 5B ns2-p7-5 2 NS2 5 unspecified role unspecified role prey prey P7 3 unspecified role unspecified role bait bait yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P27958-PRO_0000037571:p.Lys33Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:22:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys33ala' Tue Jun 30 16:26:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys33Ala' P27958-PRO_0000037571:p.Arg35Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 20:01:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg35ala' Tue Jun 30 18:08:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg35Ala' physical association physical association Fig. 4C ns2-ns5a-e2-1 1 NS2 5 unspecified role unspecified role neutral component neutral component yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5A 8 unspecified role unspecified role neutral component neutral component E2 6 unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 6A ns2-e2-5 1 E2 6 unspecified role unspecified role neutral component neutral component NS2 5 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 6B ns2-ns5a-5 1 NS2 5 unspecified role unspecified role neutral component neutral component yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5A 8 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 6B and C