UniProt UniProt http://www.uniprot.org Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. J. Virol. (0022-538X) 2010 imex curation Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca Accepted 2014-NOV-27 by ORCHARD J. Virol. (0022-538X) 2010 imex curation Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. J. Virol. (0022-538X) 2010 imex curation Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca Accepted 2014-NOV-27 by ORCHARD J. Virol. (0022-538X) 2010 imex curation Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. J. Virol. (0022-538X) 2010 imex curation Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca Accepted 2014-NOV-27 by ORCHARD J. Virol. (0022-538X) 2010 imex curation Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. J. Virol. (0022-538X) 2010 imex curation Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca Accepted 2014-NOV-27 by ORCHARD J. Virol. (0022-538X) 2010 imex curation p04585-pro_0000042447 Integrase gag-pol Pr160Gag-Pol protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 1148 1435 A39EF048DFDDB104 ima3_human Importin subunit alpha-3 KPNA4 QIP1 Karyopherin subunit alpha-4 Importin alpha Q1 protein protein human Homo sapiens Human MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF DIP protein O00629 original sequence version: 147 DIP protein O00629 original sequence version: 111 D98BC45002C9F57E vpr_hv1h2 Protein Vpr vpr R ORF protein Viral protein R protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTRQRRARNGASRS 42892A4249E83D3E kpna4-gag_pol 2 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 5A kpna4-gag_pol-1 4 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A gag_pol-kpna4 3 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 5B and 6A and B vpr-kpna4 3 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B gag_pol-kpna4-1 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait infection infection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5D