IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mutation of Asn28 disrupts the dimerization and enzymatic activity of SARS 3CL(pro) . Mutation of Asn28 disrupts the dimerization and enzymatic activity of SARS 3CL(pro) . Biochemistry 2010 imex curation Barrila J., Gabelli SB., Bacha U., Amzel LM., Freire E. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus ef@jhu.edu Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Barrila J., Gabelli SB., Bacha U., Amzel LM., Freire E. Virus - Publications including interactions involving viral proteins ef@jhu.edu Accepted 2020-JUN-15 AT 08:41 BST AT 08:41 BST by PPORRAS Biochemistry 2010 Only protein-protein interactions imex curation imex curation Mutation of Asn28 disrupts the dimerization and enzymatic activity of SARS 3CL(pro) . Mutation of Asn28 disrupts the dimerization and enzymatic activity of SARS 3CL(pro) . Biochemistry 2010 imex curation Barrila J., Gabelli SB., Bacha U., Amzel LM., Freire E. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus ef@jhu.edu Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay tag fluorescence tag visualisation by fluorescence tag fluorescence Barrila J., Gabelli SB., Bacha U., Amzel LM., Freire E. Virus - Publications including interactions involving viral proteins In the substrate, the fluorescence of the EDANS group (F) is generally quenched by the DABCYL (4-(4-dimethylaminophenylazo)benzoyl) group (Q). The DABCYL group is usually conjugated to the N-terminus and the EDANS group attached to the C-terminus of the peptide substrate. Substrate cleavage can be detected at 490 nm using an excitation wavelength of 340 nm. ef@jhu.edu Accepted 2020-JUN-15 AT 08:41 BST AT 08:41 BST by PPORRAS Biochemistry 2010 Only protein-protein interactions imex curation imex curation Mutation of Asn28 disrupts the dimerization and enzymatic activity of SARS 3CL(pro) . Mutation of Asn28 disrupts the dimerization and enzymatic activity of SARS 3CL(pro) . Biochemistry 2010 imex curation Barrila J., Gabelli SB., Bacha U., Amzel LM., Freire E. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus ef@jhu.edu Only protein-protein interactions imex curation in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Barrila J., Gabelli SB., Bacha U., Amzel LM., Freire E. Virus - Publications including interactions involving viral proteins ef@jhu.edu Accepted 2020-JUN-15 AT 08:41 BST AT 08:41 BST by PPORRAS Biochemistry 2010 Only protein-protein interactions imex curation imex curation p0c6x7-pro_0000037312 3C-like proteinase nsp5 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ 3241 3546 8A3486F9E1A9A89D dabcyl-ktsavlqsgfrkme-edans peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) KTSAVLQSGFRKME rep-92 1 4 unspecified role unspecified role neutral component neutral component purified purified P0C6X7-PRO_0000037312:p.Asn28Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N A Tue Jun 30 19:52:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn28Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 2 2.35Å Rwork: 0.214 Rfree: 0.277 dabcyl_ktsavlqsgfrkme_edans-rep-1 2 4 enzyme enzyme neutral component neutral component purified purified P0C6X7-PRO_0000037312:p.Asn28Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain N A Tue Jun 30 18:06:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn28Ala' ecoli Escherichia coli (strain K12) 5 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) protein cleavage protein cleavage Table 1, Figure 2a rep-93 3 4 unspecified role unspecified role neutral component neutral component purified purified P0C6X7-PRO_0000037312:p.Asn28Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N A Tue Jun 30 19:23:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn28Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1, Fig 3