UniProt UniProt http://www.uniprot.org Kaposi's sarcoma-associated herpesvirus viral interferon regulatory factor 4 targets MDM2 to deregulate the p53 tumor suppressor pathway. Kaposi's sarcoma-associated herpesvirus viral interferon regulatory factor 4 targets MDM2 to deregulate the p53 tumor suppressor pathway. J. Virol. (0022-538X) 2009 imex curation Lee H.R., Toth Z., Shin Y.C., Lee J.S., Chang H., Gu W., Oh T.K., Kim M.H., Jung J.U. Virus - Publications including interactions involving viral proteins MDM2 has been mapped to human protein according Ref 10 (pmid 19369353) and Ref 17 (pmid 10723139). Viral vIRF-4 has been mapped to UniProt HHV-8 reference strain. jaeujung@usc.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lee H.R., Toth Z., Shin Y.C., Lee J.S., Chang H., Gu W., Oh T.K., Kim M.H., Jung J.U. Virus - Publications including interactions involving viral proteins MDM2 has been mapped to human protein according Ref 10 (pmid 19369353) and Ref 17 (pmid 10723139). Viral vIRF-4 has been mapped to UniProt HHV-8 reference strain. jaeujung@usc.edu. jaeujung@usc.edu Accepted 2013-DEC-06 by PPORRAS J. Virol. (0022-538X) 2009 Only protein-protein interactions imex curation Kaposi's sarcoma-associated herpesvirus viral interferon regulatory factor 4 targets MDM2 to deregulate the p53 tumor suppressor pathway. Kaposi's sarcoma-associated herpesvirus viral interferon regulatory factor 4 targets MDM2 to deregulate the p53 tumor suppressor pathway. J. Virol. (0022-538X) 2009 imex curation Lee H.R., Toth Z., Shin Y.C., Lee J.S., Chang H., Gu W., Oh T.K., Kim M.H., Jung J.U. Virus - Publications including interactions involving viral proteins MDM2 has been mapped to human protein according Ref 10 (pmid 19369353) and Ref 17 (pmid 10723139). Viral vIRF-4 has been mapped to UniProt HHV-8 reference strain. jaeujung@usc.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-bcbl_1 Homo sapiens lymphoma cell line bcbl_1 Human BCBL-1 KSHV/HHV8-Infected body-cavity-based lymphoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lee H.R., Toth Z., Shin Y.C., Lee J.S., Chang H., Gu W., Oh T.K., Kim M.H., Jung J.U. Virus - Publications including interactions involving viral proteins Tetracycline-inducible TREx/BCBL-1 cells have been used, treated with TPA in presence of or absence of Dox. MDM2 has been mapped to human protein according Ref 10 (pmid 19369353) and Ref 17 (pmid 10723139). Viral vIRF-4 has been mapped to UniProt HHV-8 reference strain. jaeujung@usc.edu. jaeujung@usc.edu Accepted 2013-DEC-06 by PPORRAS J. Virol. (0022-538X) 2009 Only protein-protein interactions imex curation mdm2_human E3 ubiquitin-protein ligase Mdm2 MDM2 p53-binding protein Mdm2 Oncoprotein Mdm2 Double minute 2 protein RING-type E3 ubiquitin transferase Mdm2 protein protein human Homo sapiens Human MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP DIP protein Q00987 original sequence version: 93 DIP protein Q00987-1 original sequence version: 192 DIP protein Q00987 original sequence version: 88 DIP protein Q00987 original sequence version: 180 DIP protein Q00987 original sequence version: 188 DIP protein Q00987 original sequence version: 189 DIP protein Q00987 original sequence version: 115 DIP protein Q00987-1 original sequence version: null DIP protein Q00987 original sequence version: 149 DIP protein Q00987 original sequence version: 146 DIP protein Q00987 original sequence version: 140 DIP protein Q00987 original sequence version: 183 DIP protein Q00987 original sequence version: 145 DIP protein Q00987 original sequence version: 182 DIP protein Q00987 original sequence version: 151 DIP protein Q00987 original sequence version: 156 DIP protein Q00987-1 original sequence version: 160 DIP protein Q00987 original sequence version: 160 DIP protein Q00987 original sequence version: 168 DIP protein Q00987 original sequence version: 186 DIP protein Q00987 original sequence version: 206 F37CE163876BC983 virf4_hhv8p Viral IRF4-like protein vIRF-4 protein protein hhv8p Human herpesvirus 8 Kaposi's sarcoma-associated herpesvirus HHV-8 MPKAGGSEWATLWIIDALENNKFPYFSWFDRNNLLFAAPAPLPAGSDIPPGWYSVYHAFDEECDRVYGPSPVVGQTVYGRFGRLLRGTRRAVVRNDLRYSDTFGGSYVVWQLVRTPFKNCTYCYGAAYGPEKLQRFIQCLLSPPMQTTATRRSDTREQSYEEAGAAAPAPPKAPSGLRGRPRKSNRYYNVGDITTEQKAACSVWIPVNEGASTSGMGSSGTRQVTQASSFTWRVPGDPPAPSTLTGPSDPHSSGAGLPGTAPPKPQHETRLAGTVSGVSGVAQTPGDTGQLAPPMRDGSRLPSTSPWIPACFPWGDLPVTGWWPQGASGLPEKVHPPTTGQFDPLSPRWTYTGIPSSQLNPAAPSWIPPHAQAGTFVGEFSQGAPLAPQGLLPQSGQCASAWLPRRETGAEGACGASTEGRAPQGAASERVYPFEPQPPSAPAPGYAKPSCYNWSPLAEPPATRPIRAPVWHPPVGHAVVPEVRTPLWIPWSSGGAPNQGLSHTQGGASATPSAGAPPTPEVAERQEPSSSGIPYVCQGDNMATGYRRVTTSSGALEVEIIDLTGDSDTPSTTVASTPLPVSGPRVFQPTVLYSAPEPAVNPEVSHLPTELERRECVCPGSGERPRVPLVSTYAGDRYAVGGYGPEQSLVPPPLGLPLTLSNLQGEDICTWEEGLGNILSELQEEPSSSTRQATDRRRPRSRSPHGRRTPVSHSGPEKPPSKMFFDPPDSQRVSFVVEIFVYGNLRGTLRREGDAGEAMLCSWPVGDTLGHLCQSFVPELLRIPRLTVPSPEQMEILNRVFEGLGHGFPIFCSMSGIYSRNATQVEGWWFGNPNSRYERILRSFSPRVPQQLFNTARYLATTAAIPQTPLSVNPVTCGTVFFGASPASTENFQNVPLTVKIFIGSIWDSLH 0F82DA473774DC2D virf_4-mdm2 1 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 1A, B and D and S1 mdm2-virf_4 2 4 unspecified role unspecified role unspecified role unspecified role region au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role unspecified role unspecified role physical association physical association 4D Dox treatment