HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein. Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein. J. Virol. (0022-538X) 2009 imex curation Hara H., Aizaki H., Matsuda M., Shinkai-Ouchi F., Inoue Y., Murakami K., Shoji I., Kawakami H., Matsuura Y., Lai M.M., Miyamura T., Wakita T., Suzuki T. Virus - Publications including interactions involving viral proteins tesuzuki@nih.go.jp 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Hara H., Aizaki H., Matsuda M., Shinkai-Ouchi F., Inoue Y., Murakami K., Shoji I., Kawakami H., Matsuura Y., Lai M.M., Miyamura T., Wakita T., Suzuki T. Virus - Publications including interactions involving viral proteins tesuzuki@nih.go.jp Accepted 2014-JAN-29 by ORCHARD J. Virol. (0022-538X) 2009 imex curation Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein. Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein. J. Virol. (0022-538X) 2009 imex curation Hara H., Aizaki H., Matsuda M., Shinkai-Ouchi F., Inoue Y., Murakami K., Shoji I., Kawakami H., Matsuura Y., Lai M.M., Miyamura T., Wakita T., Suzuki T. Virus - Publications including interactions involving viral proteins tesuzuki@nih.go.jp 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hara H., Aizaki H., Matsuda M., Shinkai-Ouchi F., Inoue Y., Murakami K., Shoji I., Kawakami H., Matsuura Y., Lai M.M., Miyamura T., Wakita T., Suzuki T. Virus - Publications including interactions involving viral proteins tesuzuki@nih.go.jp Accepted 2014-JAN-29 by ORCHARD J. Virol. (0022-538X) 2009 imex curation Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein. Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein. J. Virol. (0022-538X) 2009 imex curation Hara H., Aizaki H., Matsuda M., Shinkai-Ouchi F., Inoue Y., Murakami K., Shoji I., Kawakami H., Matsuura Y., Lai M.M., Miyamura T., Wakita T., Suzuki T. Virus - Publications including interactions involving viral proteins tesuzuki@nih.go.jp 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy immunostaining immunostaining Hara H., Aizaki H., Matsuda M., Shinkai-Ouchi F., Inoue Y., Murakami K., Shoji I., Kawakami H., Matsuura Y., Lai M.M., Miyamura T., Wakita T., Suzuki T. Virus - Publications including interactions involving viral proteins tesuzuki@nih.go.jp Accepted 2014-JAN-29 by ORCHARD J. Virol. (0022-538X) 2009 imex curation p27958-pro_0000037574 Non-structural protein 4A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGKPAIIPDREVLYQEFDEMEEC 1658 1711 527EC748BC450589 q03463-pro_0000278738 Non-structural protein 4A protein protein hcvj1 Hepatitis C virus genotype 1b (isolate HC-J1) (HCV) STWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGRPAIIPDREVLYREFDEMEEC 1658 1711 51B1C748AEF2F589 q03463-pro_0000278737 Serine protease/helicase NS3 protein protein hcvj1 Hepatitis C virus genotype 1b (isolate HC-J1) (HCV) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTAAQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHVVGIFRAAVCTRGVAKAVDFIPVESLETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSVLGIGTVLDQAETAGARLVVLATATPPGSITVPHANIEEVALSTTGEIPFYGKAIPLEAIKGGRHLIFCHSKKKCDELAAKLVALGVNAVAYYRGLDVSVIPTSGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSILCECYDTGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQGGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQGEVTLTHPVTKYIMTCMSADLEVVT 1027 1657 7290E7E85AA17C90 kcrb_human Creatine kinase B-type CKB CKBB Creatine kinase B chain Brain creatine kinase Creatine phosphokinase B-type protein protein human Homo sapiens Human MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK 637AA67A86AE3059 q99ib8-pro_0000045600 Non-structural protein 4A protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV STWVLAGGVLAAVAAYCLATGCVSIIGRLHVNQRVVVAPDKEVLYEAFDEMEEC 1662 1715 03F917565EBB3B35 ns4a-ckb-2 2 5 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3B, 3D, and 3G ns4a-ckb-3 2 7 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3C ns4a-ns3-ckb-1 2 6 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey association association Fig. 3H ns4a-ckb-4 3 4 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 4B ns3-ns4a-5 2 5 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3H ns4a-ckb-5 1 4 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 4A q03463_pro-ckb-1 2 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3F