UniProt UniProt http://www.uniprot.org TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein. TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein. J. Biol. Chem. (0021-9258) 2009 imex curation Murata T., Sato Y., Nakayama S., Kudoh A., Iwahori S., Isomura H., Tajima M., Hishiki T., Ohshima T., Hijikata M., Shimotohno K., Tsurumi T. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt EBV reference proteome strain ttsurumi@aichi-cc.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-b95-8 Homo sapiens B95-8 ymphoblastoid cell line latently infected with EBV b95-8 lymphoblastoid cell line latently infected with EBV anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Murata T., Sato Y., Nakayama S., Kudoh A., Iwahori S., Isomura H., Tajima M., Hishiki T., Ohshima T., Hijikata M., Shimotohno K., Tsurumi T. Virus - Publications including interactions involving viral proteins Cells treated with TPA and A23187 Viral proteins have been mapped to the UniProt EBV reference proteome strain ttsurumi@aichi-cc.jp Accepted 2014-APR-14 by MGT J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein. TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein. J. Biol. Chem. (0021-9258) 2009 imex curation Murata T., Sato Y., Nakayama S., Kudoh A., Iwahori S., Isomura H., Tajima M., Hishiki T., Ohshima T., Hijikata M., Shimotohno K., Tsurumi T. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt EBV reference proteome strain ttsurumi@aichi-cc.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-b95-8 Homo sapiens B95-8 ymphoblastoid cell line latently infected with EBV b95-8 lymphoblastoid cell line latently infected with EBV confocal microscopy confocal microscopy immunostaining immunostaining Murata T., Sato Y., Nakayama S., Kudoh A., Iwahori S., Isomura H., Tajima M., Hishiki T., Ohshima T., Hijikata M., Shimotohno K., Tsurumi T. Virus - Publications including interactions involving viral proteins Cells were treated with doxycycline and A23187 to induce lytic EBV replication. Viral proteins have been mapped to the UniProt EBV reference proteome strain ttsurumi@aichi-cc.jp Accepted 2014-APR-14 by MGT J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein. TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein. J. Biol. Chem. (0021-9258) 2009 imex curation Murata T., Sato Y., Nakayama S., Kudoh A., Iwahori S., Isomura H., Tajima M., Hishiki T., Ohshima T., Hijikata M., Shimotohno K., Tsurumi T. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt EBV reference proteome strain ttsurumi@aichi-cc.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Murata T., Sato Y., Nakayama S., Kudoh A., Iwahori S., Isomura H., Tajima M., Hishiki T., Ohshima T., Hijikata M., Shimotohno K., Tsurumi T. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt EBV reference proteome strain ttsurumi@aichi-cc.jp Accepted 2014-APR-14 by MGT J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation crtc1_human CREB-regulated transcription coactivator 1 CRTC1 KIAA0616 MECT1 TORC1 WAMTP1 Transducer of regulated cAMP response element-binding protein 1 Mucoepidermoid carcinoma translocated protein 1 protein protein human Homo sapiens Human MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDALSLEQQLPYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSSLPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYEQQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL ECDC427FF9D6920B bzlf1_ebvb9 Trans-activator protein BZLF1 Zebra BZLF1 protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQLTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPGDNSTVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF 7F3D55D79F1F0196 crtc2_human CREB-regulated transcription coactivator 2 TORC2 Transducer of regulated cAMP response element-binding protein 2 CRTC2 protein protein human Homo sapiens Human MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRRYTRHIDSSPYSPAYLSPPPESSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPSLSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNPNLQASLSSPQPQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ DIP protein Q53ET0 original sequence version: 54 DIP protein Q53ET0 original sequence version: 1(def) DIP protein Q53ET0 original sequence version: 50 EE6C52E0ECDC1DF1 crtc3_human CREB-regulated transcription coactivator 3 CRTC3 TORC3 Transducer of regulated cAMP response element-binding protein 3 protein protein human Homo sapiens Human MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPTSQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL DIP protein Q6UUV7 original sequence version: 44 A274B96DD1C2678E crtc1-bzlf1 3 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection transducer of regulated creb activity, n-terminal required to bind necessary binding region required to bind range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2A crtc2-bzlf1 3 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined transducer of regulated creb activity, n-termina required to bind necessary binding region required to bind range range range range 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2A crtc3-bzlf1 3 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined transducer of regulated creb activity, n-terminal required to bind necessary binding region required to bind range range range range 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2A bzlf1-crtc2 1 6 unspecified role unspecified role prey prey Dephosphoprylated form 5 unspecified role unspecified role bait bait physical association physical association 3C bzlf1-crtc2-2 2 6 unspecified role unspecified role neutral component neutral component Dephosphoprylated form 5 unspecified role unspecified role neutral component neutral component colocalization colocalization 3E