MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. FEBS Lett. (0014-5793) 2008 imex curation Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2008-12-02 Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. FEBS Lett. (0014-5793) 2008 imex curation Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2008-12-02 Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. FEBS Lett. (0014-5793) 2008 imex curation Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2008-12-02 Only protein-protein interactions crisp-kidney Cricetidae sp. kidney kidney [Renal] fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. FEBS Lett. (0014-5793) 2008 imex curation Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2008-12-02 Only protein-protein interactions in vitro In vitro protein array protein array predetermined predetermined participant predetermined Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. FEBS Lett. (0014-5793) 2008 imex curation Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2008-12-02 Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. A novel association of mGluR1a with the PDZ scaffold protein CAL modulates receptor activity. FEBS Lett. (0014-5793) 2008 imex curation Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2008-12-02 Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Zhang J., Cheng S., Xiong Y., Ma Y., Luo D., Jeromin A., Zhang H., He J. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation b4f775_rat Gopc Gopc_predicted rCG_22077 protein protein rat Rattus norvegicus (Rat) Rat MEDLERELEANKTEKVKEARLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRQDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAVLAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNSGASCKDSSGEMKVLQGYNKKTVRDAHENGDVGASGESPLDDTAVRAAHPHSLHQKKAY mint 1B55D74101487BEB nhrf2_human Na(+)/H(+) exchange regulatory cofactor NHE-RF2 SLC9A3R2 NHERF2 Tyrosine kinase activator protein 1 SRY-interacting protein 1 Solute carrier family 9 isoform A3 regulatory factor 2 NHE3 kinase A regulatory protein E3KARP Sodium-hydrogen exchanger regulatory factor 2 protein protein human Homo sapiens Human MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGLHLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF 4F5D341590D22ED7 q9r0w0_rat mGluR1a protein protein rat Rattus norvegicus (Rat) Rat KMYIIIAKPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNANSNGKSVSWSEPGGRQAPKGQHVWQRLSVHV fragmentation type: fragment mint 62703476313F4B13 gopc_human Golgi-associated PDZ and coiled-coil motif-containing protein CAL FIG GOPC PDZ protein interacting specifically with TC10 CFTR-associated ligand Fused in glioblastoma protein protein human Homo sapiens Human MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY 8A19DDC376DCD0F4 nhrf1_human Na(+)/H(+) exchange regulatory cofactor NHE-RF1 SLC9A3R1 NHERF NHERF1 Ezrin-radixin-moesin-binding phosphoprotein 50 Regulatory cofactor of Na(+)/H(+) exchanger Sodium-hydrogen exchanger regulatory factor 1 Solute carrier family 9 isoform A3 regulatory factor 1 protein protein human Homo sapiens Human MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQAEPPAAAEVQGAGNENEPREADKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL E33AF87016D37A65 gopc-grm1 4 mGluR1a 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6797944: original sequence: 59-84 : SVSWSEPGGRQAPKGQHVWQRLSVH gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CAL 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6797951: original sequence: 288-368 : KVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEV his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F1 homomint domino mint slc9a3r1-grm1 4 mGluR1a 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6797964: original sequence: 59-84 : SVSWSEPGGRQAPKGQHVWQRLSVH gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NHERF-1 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6797958: original sequence: 14-91 : LCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLV direct interaction direct interaction F1 homomint domino mint slc9a3r1-grm1-1 4 mGluR1a 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6797983: original sequence: 59-84 : SVSWSEPGGRQAPKGQHVWQRLSVH gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NHERF-1 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6797977: original sequence: 154-231 : LCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLV his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F1 homomint domino mint slc9a3r2-grm1 4 mGluR1a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6797998: original sequence: 59-84 : SVSWSEPGGRQAPKGQHVWQRLSVH NHERF-2 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6797992: original sequence: 11-88 : LCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLV direct interaction direct interaction F1 homomint domino mint slc9a3r2-grm1-1 4 mGluR1a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798022: original sequence: 59-84 : SVSWSEPGGRQAPKGQHVWQRLSVH gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NHERF-2 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798016: original sequence: 151-228 : LCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLV his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F1 homomint domino mint grm1-gopc 2 mGluR1a 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798037: original sequence: 59-84 : SVSWSEPGGRQAPKGQHVWQRLSVH CAL 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798031: original sequence: 288-368 : KVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEV physical association physical association F2A homomint domino mint grm1-gopc-1 2 mGluR1a 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798061: original sequence: 59-84 : SVSWSEPGGRQAPKGQHVWQRLSVH gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CAL 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B homomint mint grm1-gopc-2 2 mGluR1a 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798074: original sequence: 59-84 : SVSWSEPGGRQAPKGQHVWQRLSVH gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CAL 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2C homomint mint gopc-grm1-1 6 mGluR1a 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798097: original sequence: 59-84 : SVSWSEPGGRQAPKGQHVWQRLSVH CAL 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798091: original sequence: 288-368 : KVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEV direct interaction direct interaction F2D homomint domino mint grm1-gopc-3 5 mGluR1a 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:19:21 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 59-84 range MINT-6798153: original sequence: 59-84 : SVSWSEPGGRQAPKGQHVWQRLSVH flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CAL 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3A F3B homomint mint gopc-grm1-2 1 CAL 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level mGluR1a 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3C homomint mint gopc-grm1-3 3 mGluR1a 9 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:25:03 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 59-84 range MINT-6798252: original sequence: 59-84 : SVSWSEPGGRQAPKGQHVWQRLSVH CAL 10 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F4 homomint mint