HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex. The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex. Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Verweij MC., Koppers-Lalic D., Loch S., Klauschies F., de la Salle H., Quinten E., Lehner PJ., Mulder A., Knittler MR., Tampé R., Koch J., Ressing ME., Wiertz EJ. Virus - Publications including interactions involving viral proteins strain Lam was used in this study based on the reference with PMID:15793001. No entry is available for the GN protein from strain Lam so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (from PMID:15793001, aa seq of GN in fig. 1B match with 99% to Q77CE4 ). Wiertz@lumc.nl 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Verweij MC., Koppers-Lalic D., Loch S., Klauschies F., de la Salle H., Quinten E., Lehner PJ., Mulder A., Knittler MR., Tampé R., Koch J., Ressing ME., Wiertz EJ. Virus - Publications including interactions involving viral proteins strain Lam was used in this study based on the reference with PMID:15793001. No entry is available for the GN protein from strain Lam so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (from PMID:15793001, aa seq of GN in fig. 1B match with 99% to Q77CE4 ). Wiertz@lumc.nl Accepted 2015-DEC-02 AT 12:29 GMT AT 12:29 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex. The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex. Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Verweij MC., Koppers-Lalic D., Loch S., Klauschies F., de la Salle H., Quinten E., Lehner PJ., Mulder A., Knittler MR., Tampé R., Koch J., Ressing ME., Wiertz EJ. Virus - Publications including interactions involving viral proteins strain Lam was used in this study based on the reference with PMID:15793001. No entry is available for the GN protein from strain Lam so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (from PMID:15793001, aa seq of GN in fig. 1B match with 99% to Q77CE4 ). Wiertz@lumc.nl 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mel_juso Homo sapiens mel_juso anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Verweij MC., Koppers-Lalic D., Loch S., Klauschies F., de la Salle H., Quinten E., Lehner PJ., Mulder A., Knittler MR., Tampé R., Koch J., Ressing ME., Wiertz EJ. Virus - Publications including interactions involving viral proteins strain Lam was used in this study based on the reference with PMID:15793001. No entry is available for the GN protein from strain Lam so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (from PMID:15793001, aa seq of GN in fig. 1B match with 99% to Q77CE4 ). Wiertz@lumc.nl Accepted 2015-DEC-02 AT 12:29 GMT AT 12:29 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex. The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex. Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Verweij MC., Koppers-Lalic D., Loch S., Klauschies F., de la Salle H., Quinten E., Lehner PJ., Mulder A., Knittler MR., Tampé R., Koch J., Ressing ME., Wiertz EJ. Virus - Publications including interactions involving viral proteins strain Lam was used in this study based on the reference with PMID:15793001. No entry is available for the GN protein from strain Lam so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (from PMID:15793001, aa seq of GN in fig. 1B match with 99% to Q77CE4 ). Wiertz@lumc.nl 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-lymphoblast Homo sapiens, lymphoblast lymphoblast Transformed lymphocytes; Blast cell; Lymphoblastoid anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Verweij MC., Koppers-Lalic D., Loch S., Klauschies F., de la Salle H., Quinten E., Lehner PJ., Mulder A., Knittler MR., Tampé R., Koch J., Ressing ME., Wiertz EJ. Virus - Publications including interactions involving viral proteins strain Lam was used in this study based on the reference with PMID:15793001. No entry is available for the GN protein from strain Lam so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (from PMID:15793001, aa seq of GN in fig. 1B match with 99% to Q77CE4 ). Wiertz@lumc.nl Accepted 2015-DEC-02 AT 12:29 GMT AT 12:29 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex. The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex. Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Verweij MC., Koppers-Lalic D., Loch S., Klauschies F., de la Salle H., Quinten E., Lehner PJ., Mulder A., Knittler MR., Tampé R., Koch J., Ressing ME., Wiertz EJ. Virus - Publications including interactions involving viral proteins strain Lam was used in this study based on the reference with PMID:15793001. No entry is available for the GN protein from strain Lam so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (from PMID:15793001, aa seq of GN in fig. 1B match with 99% to Q77CE4 ). Wiertz@lumc.nl 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mel_juso Homo sapiens mel_juso anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Verweij MC., Koppers-Lalic D., Loch S., Klauschies F., de la Salle H., Quinten E., Lehner PJ., Mulder A., Knittler MR., Tampé R., Koch J., Ressing ME., Wiertz EJ. Virus - Publications including interactions involving viral proteins strain Lam was used in this study based on the reference with PMID:15793001. No entry is available for the GN protein from strain Lam so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (from PMID:15793001, aa seq of GN in fig. 1B match with 99% to Q77CE4 ). Wiertz@lumc.nl Accepted 2015-DEC-02 AT 12:29 GMT AT 12:29 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex. The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex. Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Verweij MC., Koppers-Lalic D., Loch S., Klauschies F., de la Salle H., Quinten E., Lehner PJ., Mulder A., Knittler MR., Tampé R., Koch J., Ressing ME., Wiertz EJ. Virus - Publications including interactions involving viral proteins strain Lam was used in this study based on the reference with PMID:15793001. No entry is available for the GN protein from strain Lam so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (from PMID:15793001, aa seq of GN in fig. 1B match with 99% to Q77CE4 ). Wiertz@lumc.nl 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t2 Homo sapiens T cell leukemia/B cell line hybridoma HLA-A2-positive, TAP negative t2 T cell leukemia/B cell line hybridoma HLA-A2-positive, TAP negative ATCC CRL-1992 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Verweij MC., Koppers-Lalic D., Loch S., Klauschies F., de la Salle H., Quinten E., Lehner PJ., Mulder A., Knittler MR., Tampé R., Koch J., Ressing ME., Wiertz EJ. Virus - Publications including interactions involving viral proteins strain Lam was used in this study based on the reference with PMID:15793001. No entry is available for the GN protein from strain Lam so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (from PMID:15793001, aa seq of GN in fig. 1B match with 99% to Q77CE4 ). Wiertz@lumc.nl Accepted 2015-DEC-02 AT 12:29 GMT AT 12:29 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation tap2_human Antigen peptide transporter 2 ATP-binding cassette sub-family B member 3 Peptide transporter TAP2 Peptide supply factor 2 Peptide transporter PSF2 Peptide transporter involved in antigen processing 2 TAP2 ABCB3 PSF2 RING11 Y1 Really interesting new gene 11 protein protein protein human Homo sapiens Human MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL DIP protein Q03519 original sequence version: 123 DIP protein Q03519 original sequence version: 176 E7E4A7F6A2A3B48B gn_bhv1c Envelope glycoprotein N gN UL49.5 protein protein bhv1c Bovine herpesvirus 1.1 (strain Cooper) BoHV-1 Infectious bovine rhinotracheitis virus MPRSPLIVAVVAAALFAIVRGRDPLLDAMRREGAMDFWSAGCYARGVPLSEPPQALVVFYVALTAVMVAVALYAYGLCFRLMGASGPNKKESRGRG tap1_human Antigen peptide transporter 1 ABCB2 PSF1 RING4 Y3 TAP1 Peptide transporter TAP1 ATP-binding cassette sub-family B member 2 Peptide supply factor 1 Peptide transporter PSF1 Peptide transporter involved in antigen processing 1 Really interesting new gene 4 protein protein protein human Homo sapiens Human MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATVGSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAFVVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE DIP protein Q03518 original sequence version: 123 DIP protein Q03518 original sequence version: 173 9CA5FF96FADD6A1B tap1_rat Antigen peptide transporter 1 Tap1 Abcb2 Mtp1 ATP-binding cassette sub-family B member 2 Peptide transporter TAP1 protein protein rat Rattus norvegicus (Rat) Rat MAAHAWPTAALLLLLVDWLLLRPVLPGIFSLLVPEVPLLRVWAVGLSRWAILGLGVRGVLGVTAGARGWLAALQPLVAALGLALPGLASFRKLSAWGALREGDNAGLLHWNSRLDAFVLSYVAALPAAALWHKLGGFWAPSGHKGAGDMLCRMLGFLDSKKGRLHLVLVLLILSCLGEMAIPFFTGRITDWILQDKTAPSFARNMWLMCILTIASTVLEFAGDGIYNITMGHMHSRVHGEVFRAVLHQETGFFLKNPTGSITSRVTEDTSNVCESISDKLNLFLWYLGRGLCLLAFMIWGSFYLTVVTLLSLPLLFLLPRRLGKVYQSLAVKVQESLAKSTQVALEALSAMPTVRSFANEEGEAQKFRQKLEEMKPLNKKEALAYVTEVWTMSVSGMLLKVGILYLGGQLVVRGAVSSGNLVSFVLYQLQFTRAVEVLLSIYPSMQKSVGASEKIFEYLDRTPCSPLSGSLAPLNMKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDDATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEALAAPSD 3FA7215D0AC22EE0 q99jc6_rat Tapbp AA926063 B3galt4 Cdk2ap1-ps1 Col11a2 Daxx Hsd17b8 Kifc1 LOC224733l-1 LOC224733l-2 Phf1 Rps25-ps1 RT1-A1 RT1-A2 RT1-A3 RT1-DOa RT1-Hb RT1-Ke4 Rxrb Sacm2l-ps1 Sacm2l-ps2 Sec61-ps Syngap1 tapasin protein protein rat Rattus norvegicus (Rat) Rat MKLLPLLVVVALGLATVVVSAGPQTIECWFVEDAGGGGLSKKPATLLLRHGPRGPPPRPDLDPKLYFKVDDPAGMLLAAFRRYPAGAHAPHCEMSSYIPFPASAKWARGLSPQQNCSRALDGDWLMVSVSGTVFSLSSLLRPLPEPQREPVFITMATVVLTVLTRHPAPRIHLGKDAVLDLRFAYAPPALEDAPSVASGPPPFGLEWRRQHRGKGHLLLAAIPGLLEKMPPAREKAVAFAAWDDDNDPWGPWTGNGTLWLPAVSPSQEGVYLATVHLPYLQGQVSLELTVHKPPRVSLTPAPIVWAAPGEAPPELLCLVSHFYPEEGLEVEWELRGGPEGSSRKAEGKTWVSTVRHHSDGSVSQSGHLQLPPVTDKQHGVRYACRVRHPSLPSSGRSAEVTLEVAGFSGPSIEDGIGLFLSAFLLLGLFKALGWMAAYLTIPKILKEKASATSLTVPKDEKKSE EC39C228265BC6B0 erp27_human Endoplasmic reticulum resident protein 27 ERP27 C12orf46 Inactive protein disulfide-isomerase 27 UNQ781/PRO1575 protein protein human Homo sapiens Human MEAAPSRFMFLLFLLTCELAAEVAAEVEKSSDGPGAAQEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIPAVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKVEL D47280F6F6FDE419 tpsn_human Tapasin TAP-binding protein TAP-associated protein NGS-17 TAPBP NGS17 TAPA protein protein human Homo sapiens Human MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE 7340549519B288AD tap2_rat Antigen peptide transporter 2 Tap2 Abcb3 Mtp2 ATP-binding cassette sub-family B member 3 protein protein rat Rattus norvegicus (Rat) Rat MALSHPRPWASLLLVDLALLGLLQSSLGTLLPPGLPGLWLEGTLRLGVLWGLLKVGGLLRLVGTFLPLLCLTNPLFFSLRALVGSTMSTSVVRVASASWGWLLADYGAVALSLAVWAVLSPAGAQEKEPGQENNRALMIRLLRLSKPDLPFLIVAFIFLAMAVWWEMFIPHYSGRVIDILGGDFDPDAFASAIFFMCLFSVGSSLSAGCRGGSFLFAESRINLRIREQLFSSLLRQDLAFFQETKTGELNSRLSSDTSLMSQWLSLNANILLRSLVKVVGLYYFMLQVSPRLTFLSLLDLPLTIAAEKVYNPRHQAVLKEIQDAVAKAGQVVREAVGGLQTVRSFGAEEQEVRRYKEALERCRQLWWRRDLEKSLYLVIQRVMALGMQVLILNVGVQQILAGEVTRGGLLSFLLYQEEVGHHVQNLVYMYGDMLSNVGAAEKVFSYLDRRPNLPNPGTLAPPRLEGRVEFQDVSFSYPSRPEKPVLQGLTFTLHPGKVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGEPLVQYDHHYLHRQVVLVGQEPVLFSGSVKDNIAYGLRDCEDAQVMAAAQAACADDFIGEMTNGINTEIGEKGSQLAVGQKQRLAIARALVRNPRVLILDEATSALDAECEQALQTWRSQEDRTMLVIAHRLHTVQNADQVLVLKQGQLVEHDQLRDEQDVYAHLVQQRLEA E545993A8F784250 b2mg_human Beta-2-microglobulin B2M CDABP0092 HDCMA22P protein protein human Homo sapiens Human MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM DIP protein P61769 original sequence version: null DIP protein P61769 original sequence version: 138 DIP protein P61769 original sequence version: 134 DIP protein P61769 original sequence version: 135 DIP protein P61769 original sequence version: 116 DIP protein P61769 original sequence version: 60 DIP protein P61769 original sequence version: 79 DIP protein P61769 original sequence version: 87 DIP protein P61769 original sequence version: 93 DIP protein P61769 original sequence version: 94 DIP protein P61769 original sequence version: 91 DIP protein P61769 original sequence version: 106 DIP protein P61769 original sequence version: 111 AFD2DBEF07DCEF27 gn_bhv1c_1-tap1-2 4 12 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait association association 1C gn_bhv1c_1-tap1-1 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 2D tap1-ul49.5-1 1 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 3B interactions does not occur in cells lacking TAP2 tap1-gn_bhv1c_1-1 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 3B interactions does not occur in cells lacking TAP2 tap2-gn_bhv1c_1-3 5 13 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 4F tap2-tapasin-1 5 13 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 5D and 6C tap2-gn_bhv1c_1-1 5 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey 37 39 association association 5D and 6C tap1-multi-1 2 12 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association 1B interaction with MHC class I H chain is not addded tap1-multi-3 2 12 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association 1B interaction with MHC class I H chain is not addded tap1-tapbp-4 5 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 4F and 5D tap1-tapbp-5 5 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey association association 4D, 4F and 5D