IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interactions between M protein and other structural proteins of severe, acute respiratory syndrome-associated coronavirus. Interactions between M protein and other structural proteins of severe, acute respiratory syndrome-associated coronavirus. Journal of Biomedical Science 2008 imex curation Hsieh YC., Li HC., Chen SC., Lo SY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus losylo@mail.tcu.edu.tw 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy immunostaining immunostaining Hsieh YC., Li HC., Chen SC., Lo SY. Virus - Publications including interactions involving viral proteins losylo@mail.tcu.edu.tw Accepted 2020-SEP-21 AT 11:43 BST AT 11:43 BST by MGT Journal of Biomedical Science 2008 Only protein-protein interactions imex curation imex curation Interactions between M protein and other structural proteins of severe, acute respiratory syndrome-associated coronavirus. Interactions between M protein and other structural proteins of severe, acute respiratory syndrome-associated coronavirus. Journal of Biomedical Science 2008 imex curation Hsieh YC., Li HC., Chen SC., Lo SY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus losylo@mail.tcu.edu.tw 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hsieh YC., Li HC., Chen SC., Lo SY. Virus - Publications including interactions involving viral proteins losylo@mail.tcu.edu.tw Accepted 2020-SEP-21 AT 11:43 BST AT 11:43 BST by MGT Journal of Biomedical Science 2008 Only protein-protein interactions imex curation imex curation vme1_sars Membrane protein M E1 glycoprotein Matrix glycoprotein Membrane glycoprotein 5 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ 275C37085A0215A8 vemp_sars Envelope small membrane protein E sM 4 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV A6D9A31652DDA194 spike_sars Spike glycoprotein S E2 Peplomer protein 2 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIYQTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQDVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT DIP protein P59594 original sequence version: 48 ncap_sars Nucleoprotein N 9a Nucleocapsid protein protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA mint Major structural component of virions that associates with genomic RNA to form a long, flexible, helical nucleocapsid 43FC8750F1253034 e-m-1 2 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3a In this case, the unglycosylated, but not glycosylated, E protein was preferentially immunoprecipitated m-s-1 2 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figs. 3b, 6a-b-c Results suggested that multiple regions within M protein interacted with S protein. m-n-5 2 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figs. 3c, 4a-b-c I think, the binding regions are confusing here; the authors say M construct without first 100 aminoacids was able to interact. But again they had tested with deletion constructs of transmembrane domain (falling within 1-100 aa), and say that range 46-68 is required to bind, which is contradicting previous statement. So i have captured sufficient to bind feature alone. e-m-2 2 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supplementary Figure 1a m-e-2 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supplementary Figure 1c m-n-6 1 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figs. 2a, 7 m-s-2 1 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figs. 2a, 7 e-m-3 1 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figs. 2a, 7 e-n-2 1 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 2b n-s-1 1 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell colocalization colocalization 2b e-s-1 1 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell colocalization colocalization 2b e-m-4 2 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. S1b In this case, the unglycosylated, but not glycosylated, E protein was preferentially immunoprecipitated