IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Variable oligomerization modes in coronavirus non-structural protein 9. Variable oligomerization modes in coronavirus non-structural protein 9. Journal of molecular biology 2008 imex curation Ponnusamy R., Moll R., Weimar T., Mesters JR., Hilgenfeld R. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus hilgenfeld@biochem.uni-luebeck.de 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ponnusamy R., Moll R., Weimar T., Mesters JR., Hilgenfeld R. Virus - Publications including interactions involving viral proteins hilgenfeld@biochem.uni-luebeck.de Accepted 2020-JUL-07 AT 09:10 BST AT 09:10 BST by MGT Journal of molecular biology 2008 Only protein-protein interactions imex curation imex curation Variable oligomerization modes in coronavirus non-structural protein 9. Variable oligomerization modes in coronavirus non-structural protein 9. Journal of molecular biology 2008 imex curation Ponnusamy R., Moll R., Weimar T., Mesters JR., Hilgenfeld R. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus hilgenfeld@biochem.uni-luebeck.de 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Ponnusamy R., Moll R., Weimar T., Mesters JR., Hilgenfeld R. Virus - Publications including interactions involving viral proteins Crosslinking agent: gluteraldehyde hilgenfeld@biochem.uni-luebeck.de Accepted 2020-JUL-07 AT 09:10 BST AT 09:10 BST by MGT Journal of molecular biology 2008 Only protein-protein interactions imex curation imex curation p0c6u8-pro_0000338263 Non-structural protein 9 ORF1a polyprotein 1a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus NNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ 4118 4230 EC021D1E6D6297A0 p0c6x1-pro_0000037301 Non-structural protein 9 rep ORF1ab polyprotein 1a-1b protein protein hcov-229e Human coronavirus 229E HCoV-229E NNEIMPGKMKVKATKGEGDGGITSEGNALYNNEGGRAFMYAYVTTKPGMKYVKWEHDSGVVTVELEPPCRFVIDTPTGPQIKYLYFVKNLNNLRRGAVLGYIGATVRLQ 3825 3933 0C07F5BEB6E3CB82 rep-101 1 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 1.75Å Rwork - 0.191 Rfree - 0.225 rep-102 2 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Fig. 4 In HCoV-229E Nsp9, the wild-type showed only monomers, dimers, and trimers. rep-rep-89 2 4 unspecified role unspecified role neutral component neutral component purified purified P0C6X1-PRO_0000037301:p.Cys69Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Mon Sep 21 12:05:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys69Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified P0C6X1-PRO_0000037301:p.Cys69Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Thu Sep 17 11:41:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys69Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4 p0c6u8_pro_0000338263-p0c6u8_pro_0000338263-1 2 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4 rep-105 2 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Fig. 4 In HCoV-229E Nsp9, the wild-type showed only monomers, dimers, and trimers. rep-106 1 4 unspecified role unspecified role neutral component neutral component purified purified P0C6X1-PRO_0000037301:p.Cys69Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed Sep 16 10:34:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys69Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 The conditions identified for crystallisation of the wild-type Nsp9 failed to yield crystals of the mutant, so the conditions were modified accordingly