MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Molecular mimicry between IL-33 and KSHV for attachment to chromatin through the H2A-H2B acidic pocket. Molecular mimicry between IL-33 and KSHV for attachment to chromatin through the H2A-H2B acidic pocket. EMBO Rep. (1469-221X) 2008 imex curation Roussel L., Erard M., Cayrol C., Girard JP. Virus - Publications including interactions involving viral proteins 2008-11-28 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Roussel L., Erard M., Cayrol C., Girard JP. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2008 2008-11-28 Only protein-protein interactions imex curation h2b1c_human Histone H2B type 1-C/E/F/G/I HIST1H2BG HIST1H2BI Histone H2B.1 A Histone H2B.a Histone H2B.g Histone H2B.h Histone H2B.k Histone H2B.l H2BC10 H2BC4 H2BC6 H2BC7 H2BC8 H2BFA H2BFG H2BFH H2BFK H2BFL HIST1H2BC HIST1H2BE HIST1H2BF protein protein human Homo sapiens Human MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK DIP protein P62807 original sequence version: 129 DIP protein P62807 original sequence version: 131 DIP protein P62807 original sequence version: 84 FAE1479F44BE703D q9dum3_hhv8 protein protein hhv8 Human herpesvirus 8 (HHV-8) Kaposi's sarcoma-associated herpesvirus HHV-8 MAPPGMRLRSGRSTGAPLTRGSCRKRNRSPERCDLGDDLHLQPRRKHVADSVDGRECGPHTLPIPGSPTVFTSGLPAFVSSPTLPVASIPSPAPATPLPPPALLPPVTTSSSPIPPSHPVSPGTTDTHSPSPALPPTQSPESSQRPPLSSPTGRPDSSTPMRPPPSQQTTPPHSPTTPPPEPPSKSSPDSLAPSTLRSLRKRRLSSPQGPSTLNPICQSPPVSPPRCDFANRSVYPPWATESPIYVGSSSDGDTPPRQPPTSPISIGSSSPSEGSSGDDTAMLVLLAEIAEEASKNEKECSENNQAGEDNGDNEISKESQVDKDDNDNKDDEEEQETDEEDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEEDEEEDEEEDEEEEDEEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPLQEPQQQEPQQQEPQQQEPQQQEPLQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELDEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQEQELEEVEEQEQEQEEQELEEVEEQEQEQEEQEEQELEEVEEQEEQELEEVEEQEEQELEEVEEQEQQGVEQQEQETVEEPIILHGSSSEDEMEVDYPVVSTHEQIASSPPGDNTPDDDPQPGPSREYRYVLRTSPPHRPGVRMRRVPVTHPKKPHPRYQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQPGENQGPGDSPQEMT fragmentation type: fragment mint 2959EDD2C1C042B8 h2a1_human Histone H2A type 1 H2AC11 H2AC13 H2AC15 H2AC16 H2AC17 H2AFC H2AFD H2AFI H2AFN H2AFP HIST1H2AG HIST1H2AI HIST1H2AK HIST1H2AL HIST1H2AM Histone H2A/ptl protein protein human Homo sapiens Human MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK DIP protein P0C0S8 original sequence version: 65 48DD539793FE8256 il33_human Interleukin-33 Interleukin-1 family member 11 Nuclear factor from high endothelial venules IL33 C9orf26 IL1F11 NFHEV protein protein human Homo sapiens Human MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET DIP protein O95760 original sequence version: 98 7C158069196EF636 il33-hist1h2ag 1 H2B 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level H2A 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level IL33 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6802707: original sequence: 40-58 : CPMYFMKLRSGLMIKKEA O95760:p.Arg48Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:23:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:33:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg48ala' Tue Jun 30 16:31:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg48Ala' range MINT-6802710: original sequence: 48-48 : EVCPMYFMKLRSGLMIKKEA association association F2E F2F F2G homomint mint q9dum3-hist1h2ag 1 IL33 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:45:48 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Arg48Ala range MINT-6802737: original sequence: 48-48 : DLHLQPRRKHVADSVDGREC binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6802741: original sequence: 5-22 : GMRLRSGRSTGAPLTRG gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined H2A 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level H2B 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association F2E F2F F2G homomint mint il33-hist1h2ag-1 1 H2A 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:45:45 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 91-93 range MINT-6802790: original sequence: 91-93 : PRHLQLAIRNDEELNKLLGKVT IL33 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6802782: original sequence: 40-58 : CPMYFMKLRSGLMIKKEA gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F4B homomint mint q9dum3-hist1h2ag-1 1 LANA 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6802796: original sequence: 5-14 : MAPPGMRLRSGRSTGAPLTRGSC gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined H2A 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level P0C0S8:p.Glu92Arg mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R Tue Jul 12 10:21:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 14:42:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu92arg' Tue Jun 30 20:00:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu92Arg' range MINT-6802810: original sequence: 92-92 : RHLQLAIRNDEELNKLLGKV P0C0S8:p.Glu93Leu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E L Tue Jul 12 10:19:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:08:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu93leu' Tue Jun 30 20:16:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu93Leu' range MINT-6802802: original sequence: 93-93 : HLQLAIRNDEELNKLLGKVT physical association physical association F4B homomint mint q9dum3-hist1h2ag-2 1 LANA 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6802816: original sequence: 5-14 : MAPPGMRLRSGRSTGAPLTRGSC H2A 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:43:50 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 91-93 range MINT-6802822: original sequence: 91-93 : PRHLQLAIRNDEELNKLLGKVT physical association physical association F4B homomint mint il33-hist1h2ag-2 1 H2A 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level P0C0S8:p.Glu93Leu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E L Tue Jul 12 10:55:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:18:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu93leu' Tue Jun 30 18:23:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu93Leu' range MINT-6802845: original sequence: 93-93 : HLQLAIRNDEELNKLLGKVT P0C0S8:p.Glu92Arg mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R Tue Jul 12 10:17:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:00:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu92arg' Tue Jun 30 18:39:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu92Arg' range MINT-6802843: original sequence: 92-92 : RHLQLAIRNDEELNKLLGKV IL33 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6802839: original sequence: 40-58 : CPMYFMKLRSGLMIKKEA gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F4B homomint mint