MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Vaccinia virus E3 protein prevents the antiviral action of ISG15. Vaccinia virus E3 protein prevents the antiviral action of ISG15. PLoS Pathog. (1553-7366) 2008 rapid curation Guerra S., Cáceres A., Knobeloch KP., Horak I., Esteban M. Virus - Publications including interactions involving viral proteins suggested by panni sguerra@cnb.csic.es rapid curation unknown Unknown fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Guerra S., Cáceres A., Knobeloch KP., Horak I., Esteban M. Virus - Publications including interactions involving viral proteins suggested by panni sguerra@cnb.csic.es PLoS Pathog. (1553-7366) 2008 rapid curation rapid curation Vaccinia virus E3 protein prevents the antiviral action of ISG15. Vaccinia virus E3 protein prevents the antiviral action of ISG15. PLoS Pathog. (1553-7366) 2008 rapid curation Guerra S., Cáceres A., Knobeloch KP., Horak I., Esteban M. Virus - Publications including interactions involving viral proteins suggested by panni sguerra@cnb.csic.es rapid curation unknown Unknown anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Guerra S., Cáceres A., Knobeloch KP., Horak I., Esteban M. Virus - Publications including interactions involving viral proteins suggested by panni sguerra@cnb.csic.es PLoS Pathog. (1553-7366) 2008 rapid curation rapid curation e3_vaccw Protein E3 p25 E3L VACWR059 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MSKIYIDERSNAEIVCEAIKTIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKGANPVTVINEYCQITRRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF C76888864BE662AC ub2l6_human Ubiquitin/ISG15-conjugating enzyme E2 L6 UBE2L6 UBCH8 Ubiquitin-protein ligase L6 Ubiquitin carrier protein L6 UbcH8 Retinoic acid-induced gene B protein E2 ubiquitin-conjugating enzyme L6 protein protein human Homo sapiens Human MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS DIP protein O14933 original sequence version: 136 D79768775344EFAE e3-ube2l6 2 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association F5 homomint mint e3-ube2l6-1 1 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component colocalization colocalization F5 homomint mint