MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Enhanced binding of TBK1 by an optineurin mutant that causes a familial form of primary open angle glaucoma. Enhanced binding of TBK1 by an optineurin mutant that causes a familial form of primary open angle glaucoma. FEBS Lett. (0014-5793) 2008 imex curation Morton S., Hesson L., Peggie M., Cohen P. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2009-01-08 Only protein-protein interactions human-il-1r Homo sapiens il-1r il-1r anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Morton S., Hesson L., Peggie M., Cohen P. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2009-01-08 Only protein-protein interactions imex curation Enhanced binding of TBK1 by an optineurin mutant that causes a familial form of primary open angle glaucoma. Enhanced binding of TBK1 by an optineurin mutant that causes a familial form of primary open angle glaucoma. FEBS Lett. (0014-5793) 2008 imex curation Morton S., Hesson L., Peggie M., Cohen P. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2009-01-08 Only protein-protein interactions human-il-1r Homo sapiens il-1r il-1r pull down pull down anti tag western anti tag western blot anti tag western Morton S., Hesson L., Peggie M., Cohen P. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2009-01-08 Only protein-protein interactions imex curation tank_human TRAF family member-associated NF-kappa-B activator TANK ITRAF TRAF2 TRAF-interacting protein protein protein human Homo sapiens Human MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPRKETSARSLGSPLLHERGNIEKTFWDLKEEFHKICMLAKAQKDHLSKLNIPDTATETQCSVPIQCTDKTDKQEALFKPQAKDDINRGAPSITSVTPRGLCRDEEDTSFESLSKFNVKFPPMDNDSTFLHSTPERPGILSPATSEAVCQEKFNMEFRDNPGNFVKTEETLFEIQGIDPIASAIQNLKTTDKTKPSNLVNTCIRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGKAIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSHFNGET 718D30CF03EB27FF tbk1_human Serine/threonine-protein kinase TBK1 TBK1 NAK TANK-binding kinase 1 T2K NF-kappa-B-activating kinase protein protein human Homo sapiens Human MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL DIP protein Q9UHD2 original sequence version: 116 DIP protein Q9UHD2 original sequence version: 120 DIP protein Q9UHD2 original sequence version: 79 DIP protein Q9UHD2 original sequence version: null B58E4FE1B502276D optn_human Optineurin HYPL Optic neuropathy-inducing protein E3-14.7K-interacting protein FIP-2 Huntingtin-interacting protein L Huntingtin yeast partner L NEMO-related protein Transcription factor IIIA-interacting protein OPTN FIP2 GLC1E NRP HIP7 Huntingtin-interacting protein 7 protein protein human Homo sapiens Human MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII DIP protein Q96CV9 original sequence version: 65 2BAF841BA515AAE2 tbk1-optn 2 OPTN 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96CV9:p.Glu50Lys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Tue Jul 12 10:07:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 14:28:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu50lys' Tue Jun 30 18:20:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu50Lys' range MINT-6492318: original sequence: 50-50 : LLQQMKELLTENHQLKEAMK TBK1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A F2C homomint mint tbk1-optn-1 2 OPTN 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q96CV9:p.Glu50Lys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Tue Jul 12 10:07:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 14:33:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu50lys' Tue Jun 30 17:10:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu50Lys' range MINT-6492345: original sequence: 50-50 : LLQQMKELLTENHQLKEAMK binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6492353: original sequence: 1-127 : MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPT ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TBK1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2A homomint mint tbk1-optn-2 2 TBK1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined OPTN 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6492359: original sequence: 1-127 : MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPT ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96CV9:p.Met98Lys mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M K Tue Jul 12 10:05:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:10:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met98lys' Tue Jun 30 19:47:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met98Lys' range MINT-6492363: original sequence: 98-98 : IQSKEAKERLMALSHENEKL physical association physical association F2A homomint mint tbk1-optn-3 2 TBK1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:45:11 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 688-729 range MINT-6492442: original sequence: 688-729 : LGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDC gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined OPTN 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3 homomint mint tbk1-tank-3 2 TBK1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:56 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 688-729 range MINT-6492450: original sequence: 688-729 : LGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDC TANK 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3 homomint mint optn-tbk1-1 2 OPTN 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96CV9:p.Glu50Lys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Tue Jul 12 10:12:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:37:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu50lys' Tue Jun 30 18:04:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu50Lys' range MINT-6492475: original sequence: 50-50 : LLQQMKELLTENHQLKEAMK TBK1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1D homomint mint optn-tbk1-2 1 TBK1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined OPTN 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q96CV9:p.Glu50Lys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Tue Jul 12 10:12:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:51:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu50lys' Tue Jun 30 19:52:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu50Lys' range MINT-6492328: original sequence: 50-50 : LLQQMKELLTENHQLKEAMK ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B homomint mint optn-tbk1-3 1 TBK1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level OPTN 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F1C homomint mint optn-tbk1-4 1 TBK1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level OPTN 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96CV9:p.Glu50Lys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain E K Tue Jul 12 10:13:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:21:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu50lys' Tue Jun 30 16:54:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu50Lys' range MINT-6492535: original sequence: 50-50 : LLQQMKELLTENHQLKEAMK physical association physical association F1E homomint mint