MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The autoimmune regulator PHD finger binds to non-methylated histone H3K4 to activate gene expression. The autoimmune regulator PHD finger binds to non-methylated histone H3K4 to activate gene expression. EMBO Rep. (1469-221X) 2008 imex curation Org T., Chignola F., Hetényi C., Gaetani M., Rebane A., Liiv I., Maran U., Mollica L., Bottomley MJ., Musco G., Peterson P. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Org T., Chignola F., Hetényi C., Gaetani M., Rebane A., Liiv I., Maran U., Mollica L., Bottomley MJ., Musco G., Peterson P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2008 2009-01-08 Only protein-protein interactions imex curation The autoimmune regulator PHD finger binds to non-methylated histone H3K4 to activate gene expression. The autoimmune regulator PHD finger binds to non-methylated histone H3K4 to activate gene expression. EMBO Rep. (1469-221X) 2008 imex curation Org T., Chignola F., Hetényi C., Gaetani M., Rebane A., Liiv I., Maran U., Mollica L., Bottomley MJ., Musco G., Peterson P. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Org T., Chignola F., Hetényi C., Gaetani M., Rebane A., Liiv I., Maran U., Mollica L., Bottomley MJ., Musco G., Peterson P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2008 2009-01-08 Only protein-protein interactions imex curation The autoimmune regulator PHD finger binds to non-methylated histone H3K4 to activate gene expression. The autoimmune regulator PHD finger binds to non-methylated histone H3K4 to activate gene expression. EMBO Rep. (1469-221X) 2008 imex curation Org T., Chignola F., Hetényi C., Gaetani M., Rebane A., Liiv I., Maran U., Mollica L., Bottomley MJ., Musco G., Peterson P. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Org T., Chignola F., Hetényi C., Gaetani M., Rebane A., Liiv I., Maran U., Mollica L., Bottomley MJ., Musco G., Peterson P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2008 2009-01-08 Only protein-protein interactions imex curation The autoimmune regulator PHD finger binds to non-methylated histone H3K4 to activate gene expression. The autoimmune regulator PHD finger binds to non-methylated histone H3K4 to activate gene expression. EMBO Rep. (1469-221X) 2008 imex curation Org T., Chignola F., Hetényi C., Gaetani M., Rebane A., Liiv I., Maran U., Mollica L., Bottomley MJ., Musco G., Peterson P. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Org T., Chignola F., Hetényi C., Gaetani M., Rebane A., Liiv I., Maran U., Mollica L., Bottomley MJ., Musco G., Peterson P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2008 2009-01-08 Only protein-protein interactions imex curation h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P68431 original sequence version: 78 DIP protein P68431 original sequence version: 79 DIP protein P68431 original sequence version: 76 DIP protein P68431 original sequence version: 92 DIP protein P68431 original sequence version: 87 DIP protein P68431 original sequence version: 101 DIP protein P68431 original sequence version: 130 DIP protein P68431 original sequence version: 115 9B89008EA50A0EF6 aire_human Autoimmune regulator AIRE APECED Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein protein protein human Homo sapiens Human MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPRKGRKPPAVPKALVPPPRLPTKRKASEEARAAAPAALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVAMSSGDVPGARGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDSGSGKNKARSSSGPKPLVRAKGAQGAAPGGGEARLGQQGSVPAPLALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAPSPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS 8CF703F8C9411BC5 h2b1b_human Histone H2B type 1-B H2BC3 H2B-clustered histone 3 H2BFF HIST1H2BB Histone H2B.1 Histone H2B.f protein protein human Homo sapiens Human MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK DIP protein P33778 original sequence version: 97 DIP protein P33778 original sequence version: 146 D2D6B95A9A344EF7 aire-hist1h3b 4 AIRE 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6542119: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE H3 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association F1B F1C SF1 homomint mint aire-hist1h3b-1 4 AIRE 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:53:10 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Asp294Ala range MINT-6542465: original sequence: 294-294 : ALPSDPQLHQKNEDECAVCR gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6542126: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE H3 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction F1D F4A homomint mint aire-hist1h2bb 4 AIRE 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542142: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined H3 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level H2B 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association F1E homomint mint hist1h3b-aire 4 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified trimethyllysine n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6542174: original sequence: 10-10 : MARTKQTARKSTGGKAPRK binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542172: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL AIRE 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6542160: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE direct interaction direct interaction F1G homomint mint hist1h3b-aire-1 4 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542433: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL trimethyllysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6542431: original sequence: 5-5 : MARTKQTARKSTGG AIRE 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6542427: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F1G homomint mint hist1h3b-aire-2 4 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542443: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL trimethyllysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6542441: original sequence: 5-5 : MARTKQTARKSTGG AIRE 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O43918:p.Asp297Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:58:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:00:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp297ala' Tue Jun 30 18:18:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp297Ala' range MINT-6542458: original sequence: 297-297 : SDPQLHQKNEDECAVCRDGG binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6542448: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE direct interaction direct interaction F1G F4B homomint mint aire-hist1h3b-2 1 AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542183: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified trimethyllysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6542187: original sequence: 5-5 : MARTKQTARKSTGG binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542189: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL direct interaction direct interaction F2 homomint mint aire-hist1h3b-3 1 AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542207: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542213: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL trimethyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6542211: original sequence: 5-5 : MARTKQTARKSTGG direct interaction direct interaction F2 homomint mint aire-hist1h3b-4 1 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542223: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL trimethyllysine n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6542221: original sequence: 5-5 : MARTKQTARKSTGG AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542228: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE direct interaction direct interaction SF2B homomint mint aire-hist1h3b-5 1 AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542390: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542396: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL direct interaction direct interaction SF2A F2 homomint mint aire-hist1h3b-6 3 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542412: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified O43918:p.Asp312Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:49:58 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:14:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp312ala' Tue Jun 30 18:22:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp312Ala' range MINT-6542472: original sequence: 312-312 : CRDGGELICCDGCPRAFHLA binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542417: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE direct interaction direct interaction kd 6.5 micromolar T1 F4C homomint mint aire-hist1h3b-7 3 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542480: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542487: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE O43918:p.Asp297Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:07:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:36:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp297ala' Tue Jun 30 17:02:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp297Ala' range MINT-6542484: original sequence: 297-297 : SDPQLHQKNEDECAVCRDGG direct interaction direct interaction T1 F4C kd 146 micromolar homomint mint aire-hist1h3b-8 3 AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542500: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542504: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL methyllysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6542511: original sequence: 5-5 : MARTKQTARKSTGG direct interaction direct interaction T1 kd 55.6 micromolar homomint mint aire-hist1h3b-9 3 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542519: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL methyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6542517: original sequence: 5-5 : MARTKQTARKSTGG AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542524: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE direct interaction direct interaction T1 kd 714 micromolar homomint mint aire-hist1h3b-10 2 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542537: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified O43918:p.Asp312Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:05:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:46:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp312ala' Tue Jun 30 18:13:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp312Ala' range MINT-6542541: original sequence: 312-312 : CRDGGELICCDGCPRAFHLA binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542544: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE direct interaction direct interaction kd 4.7 micromolar T1 SF2C homomint mint aire-hist1h3b-11 2 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542562: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542556: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE O43918:p.Cys311Tyr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C Y Tue Jul 12 10:15:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:47:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys311tyr' Tue Jun 30 16:41:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys311Tyr' range MINT-6542558: original sequence: 311-311 : VCRDGGELICCDGCPRAFHL direct interaction direct interaction kd 4.7 micromolar T1 SF2C homomint mint aire-hist1h3b-12 2 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542571: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542578: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE O43918:p.Val301Met mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V M Tue Jul 12 10:52:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:56:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val301met' Tue Jun 30 18:59:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val301Met' range MINT-6542575: original sequence: 301-301 : LHQKNEDECAVCRDGGELIC direct interaction direct interaction T1 SF2C kd 6.8 micromolar homomint mint aire-hist1h3b-13 2 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542596: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542592: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE O43918:p.Asp297Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:52:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:41:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp297ala' Tue Jun 30 18:01:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp297Ala' range MINT-6542589: original sequence: 297-297 : SDPQLHQKNEDECAVCRDGG direct interaction direct interaction T1 SF2C kd 173 micromolar homomint mint aire-hist1h3b-14 2 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6542620: original sequence: 5-5 : MARTKQTARKSTGG binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542606: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542611: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE direct interaction direct interaction T1 SF2C kd 21.4 micromolar homomint mint aire-hist1h3b-15 2 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542634: original sequence: 2-22 : ARTKQTARKSTGGKAPRKQL methyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6542632: original sequence: 5-5 : MARTKQTARKSTGG AIRE 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6542628: original sequence: 293-354 : QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAE direct interaction direct interaction T1 SF2C kd >500 micromolar homomint mint