IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The nucleocapsid protein of SARS-associated coronavirus inhibits B23 phosphorylation. The nucleocapsid protein of SARS-associated coronavirus inhibits B23 phosphorylation. Biochemical and biophysical research communications 2008 imex curation Zeng Y., Ye L., Zhu S., Zheng H., Zhao P., Cai W., Su L., She Y., Wu Z. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Linbaiye@whu.edu.cn Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zeng Y., Ye L., Zhu S., Zheng H., Zhao P., Cai W., Su L., She Y., Wu Z. Virus - Publications including interactions involving viral proteins Linbaiye@whu.edu.cn Accepted 2020-JUN-01 AT 13:04 BST AT 13:04 BST by ORCHARD Biochemical and biophysical research communications 2008 Only protein-protein interactions imex curation imex curation The nucleocapsid protein of SARS-associated coronavirus inhibits B23 phosphorylation. The nucleocapsid protein of SARS-associated coronavirus inhibits B23 phosphorylation. Biochemical and biophysical research communications 2008 imex curation Zeng Y., Ye L., Zhu S., Zheng H., Zhao P., Cai W., Su L., She Y., Wu Z. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Linbaiye@whu.edu.cn Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zeng Y., Ye L., Zhu S., Zheng H., Zhao P., Cai W., Su L., She Y., Wu Z. Virus - Publications including interactions involving viral proteins Linbaiye@whu.edu.cn Accepted 2020-JUN-01 AT 13:04 BST AT 13:04 BST by ORCHARD Biochemical and biophysical research communications 2008 Only protein-protein interactions imex curation imex curation The nucleocapsid protein of SARS-associated coronavirus inhibits B23 phosphorylation. The nucleocapsid protein of SARS-associated coronavirus inhibits B23 phosphorylation. Biochemical and biophysical research communications 2008 imex curation Zeng Y., Ye L., Zhu S., Zheng H., Zhao P., Cai W., Su L., She Y., Wu Z. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Linbaiye@whu.edu.cn Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Zeng Y., Ye L., Zhu S., Zheng H., Zhao P., Cai W., Su L., She Y., Wu Z. Virus - Publications including interactions involving viral proteins Linbaiye@whu.edu.cn Accepted 2020-JUN-01 AT 13:04 BST AT 13:04 BST by ORCHARD Biochemical and biophysical research communications 2008 Only protein-protein interactions imex curation imex curation q6upd4_sars Nucleoprotein NP N Nucleocapsid protein protein protein SARS coronavirus HB SARS coronavirus HB MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRARGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNRLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA 524B35B89433BA07 npm_human Nucleophosmin NPM1 NPM Nucleolar phosphoprotein B23 Numatrin Nucleolar protein NO38 protein protein human Homo sapiens Human MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL 620BC7BA2E4A0054 np-npm1-2 3 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell colocalization colocalization Fig. 1 np-npm1-3 2 5 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 4 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain SR-rich domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Figs. 2a-b, 3a-b np-npm1-4 2 5 unspecified role unspecified role prey prey purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2c There is mismatch of tag details mentioned in Fig. 2c and text; however in the materials & methods and main text it is clear that phosphoprotein B23 is his tagged, not the SARS CoV N protein and the same has been followed np-npm1-5 1 5 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Fig. 2d