UniProt UniProt http://www.uniprot.org The histone chaperone protein Nucleosome Assembly Protein-1 (hNAP-1) binds HIV-1 Tat and promotes viral transcription. The histone chaperone protein Nucleosome Assembly Protein-1 (hNAP-1) binds HIV-1 Tat and promotes viral transcription. Retrovirology 2008 imex curation Vardabasso C., Manganaro L., Lusic M., Marcello A., Giacca M. Virus - Publications including interactions involving viral proteins HIV-1 tat has been mapped to the UniProt HIV-1 reference strain marcello@icgeb.org Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Vardabasso C., Manganaro L., Lusic M., Marcello A., Giacca M. Virus - Publications including interactions involving viral proteins HIV-1 tat has been mapped to the UniProt HIV-1 reference strain marcello@icgeb.org Accepted 2015-MAR-02 by MGT Retrovirology 2008 imex curation The histone chaperone protein Nucleosome Assembly Protein-1 (hNAP-1) binds HIV-1 Tat and promotes viral transcription. The histone chaperone protein Nucleosome Assembly Protein-1 (hNAP-1) binds HIV-1 Tat and promotes viral transcription. Retrovirology 2008 imex curation Vardabasso C., Manganaro L., Lusic M., Marcello A., Giacca M. Virus - Publications including interactions involving viral proteins HIV-1 tat has been mapped to the UniProt HIV-1 reference strain marcello@icgeb.org Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Vardabasso C., Manganaro L., Lusic M., Marcello A., Giacca M. Virus - Publications including interactions involving viral proteins HIV-1 tat has been mapped to the UniProt HIV-1 reference strain marcello@icgeb.org Accepted 2015-MAR-02 by MGT Retrovirology 2008 imex curation The histone chaperone protein Nucleosome Assembly Protein-1 (hNAP-1) binds HIV-1 Tat and promotes viral transcription. The histone chaperone protein Nucleosome Assembly Protein-1 (hNAP-1) binds HIV-1 Tat and promotes viral transcription. Retrovirology 2008 imex curation Vardabasso C., Manganaro L., Lusic M., Marcello A., Giacca M. Virus - Publications including interactions involving viral proteins HIV-1 tat has been mapped to the UniProt HIV-1 reference strain marcello@icgeb.org Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Vardabasso C., Manganaro L., Lusic M., Marcello A., Giacca M. Virus - Publications including interactions involving viral proteins HIV-1 tat has been mapped to the UniProt HIV-1 reference strain marcello@icgeb.org Accepted 2015-MAR-02 by MGT Retrovirology 2008 imex curation The histone chaperone protein Nucleosome Assembly Protein-1 (hNAP-1) binds HIV-1 Tat and promotes viral transcription. The histone chaperone protein Nucleosome Assembly Protein-1 (hNAP-1) binds HIV-1 Tat and promotes viral transcription. Retrovirology 2008 imex curation Vardabasso C., Manganaro L., Lusic M., Marcello A., Giacca M. Virus - Publications including interactions involving viral proteins HIV-1 tat has been mapped to the UniProt HIV-1 reference strain marcello@icgeb.org Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Vardabasso C., Manganaro L., Lusic M., Marcello A., Giacca M. Virus - Publications including interactions involving viral proteins HIV-1 tat has been mapped to the UniProt HIV-1 reference strain marcello@icgeb.org Accepted 2015-MAR-02 by MGT Retrovirology 2008 imex curation The histone chaperone protein Nucleosome Assembly Protein-1 (hNAP-1) binds HIV-1 Tat and promotes viral transcription. The histone chaperone protein Nucleosome Assembly Protein-1 (hNAP-1) binds HIV-1 Tat and promotes viral transcription. Retrovirology 2008 imex curation Vardabasso C., Manganaro L., Lusic M., Marcello A., Giacca M. Virus - Publications including interactions involving viral proteins HIV-1 tat has been mapped to the UniProt HIV-1 reference strain marcello@icgeb.org Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Vardabasso C., Manganaro L., Lusic M., Marcello A., Giacca M. Virus - Publications including interactions involving viral proteins HIV-1 tat has been mapped to the UniProt HIV-1 reference strain marcello@icgeb.org Accepted 2015-MAR-02 by MGT Retrovirology 2008 imex curation c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ DIP protein Q07021 original sequence version: 129 DIP protein Q07021 original sequence version: 156 2F747FA73BB1314B npm_human Nucleophosmin NPM1 NPM Nucleolar phosphoprotein B23 Numatrin Nucleolar protein NO38 protein protein human Homo sapiens Human MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL 620BC7BA2E4A0054 tat_hv1h2 Protein Tat tat Transactivating regulatory protein protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE 4DDC56D979769115 4DDC56D979769115 np1l1_human Nucleosome assembly protein 1-like 1 NAP1L1 NRP NAP-1-related protein protein protein human Homo sapiens Human MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ E5B2EAA4EAE551D2 tat-c1qbp 3 8 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association 1 Another protein - "ribosomal protein S4" was also isolated, but the identity of this protein is not stated. tat-nap1l1 5 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2c and 4d Interaction is enhanced by histone acetyltransferase p300 tat-nap1l1-1 4 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 9 unspecified role unspecified role prey prey physical association physical association 2d tat-nap1l1-2 1 8 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range true ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey cell lysate cell lysate human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 2e nap1l1-tat-2 2 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 3a and b nap1l1-tat-3 2 8 unspecified role unspecified role bait bait c_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range true region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P04608:p.[Arg49Ala;Arg52_Arg53delinsAlaAla;Arg55_Arg57delinsAlaAlaAla] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain RR AA certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain RRR AAA Thu Jul 07 12:07:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was arg49ala_arg52-53ala_arg55-57ala Fri Jul 22 11:12:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg49ala,arg52ala,arg53ala,arg55ala,arg56ala,arg57ala' Wed May 02 15:17:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg49ala,arg_arg52-53ala_ala,arg_arg_arg55-57ala_ala_ala' Tue Jun 30 16:27:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg49Ala;Arg52_Arg53delinsAlaAla;Arg55_Arg57delinsAlaAlaAla]' ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association 3c and d