HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. Biochemistry (0006-2960) 2008 imex curation Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro chromatography chromatography technology column chromatography chromatography predetermined predetermined participant predetermined Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu Accepted 2013-JUL-08 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Biochemistry (0006-2960) 2008 imex curation RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. Biochemistry (0006-2960) 2008 imex curation Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu Accepted 2013-JUL-08 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Biochemistry (0006-2960) 2008 imex curation RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. Biochemistry (0006-2960) 2008 imex curation Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down tag fluorescence tag visualisation by fluorescence tag fluorescence Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu Accepted 2013-JUL-08 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Biochemistry (0006-2960) 2008 imex curation RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. Biochemistry (0006-2960) 2008 imex curation Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins Cross-linkin agent bis(sulfosuccinimidyl)suberate (BS3) raneykevind@uams.edu Accepted 2013-JUL-08 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Biochemistry (0006-2960) 2008 imex curation RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. Biochemistry (0006-2960) 2008 imex curation Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr weight identificat confirmation by molecular weight weight identificat Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu Accepted 2013-JUL-08 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Biochemistry (0006-2960) 2008 imex curation RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. Biochemistry (0006-2960) 2008 imex curation Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu Accepted 2013-JUL-08 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Biochemistry (0006-2960) 2008 imex curation p26663-pro_0000037540 RNA-directed RNA polymerase protein protein hcvbk Hepatitis C virus genotype 1b (isolate BK) HCV SMSYTWTGALITPCAAEESKLPINALSNSLLRHHNMVYATTSRSAGLRQKKVTFDRLQVLDDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSAKSKFGYGAKDVRNLSSKAVNHIHSVWKDLLEDTVTPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSTLPQVVMGSSYGFQYSPGQRVEFLVNTWKSKKNPMGFSYDTRCFDSTVTENDIRVEESIYQCCDLAPEARQAIKSLTERLYIGGPLTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKASAACRAAKLQDCTMLVNGDDLVVICESAGTQEDAASLRVFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGACYSIEPLDLPQIIERLHGLSAFSLHSYSPGEINRVASCLRKLGVPPLRVWRHRARSVRARLLSQGGRAATCGKYLFNWAVKTKLKLTPIPAASRLDLSGWFVAGYSGGDIYHSLSRARPRWFMLCLLLLSVGVGIYLLPNR 2420 3010 BD72C870B823E3D1 q9wmx2-pro_0000037548 Serine protease/helicase NS3 protein protein hcvco Hepatitis C virus genotype 1b (isolate Con1) (HCV) APITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSADLEVVT 1027 1657 A84CEABAAB30E03E ns3-ns5b-3 2 NS5B 7 unspecified role unspecified role prey prey NS3 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1 p26663_pro-q9wmx2_pr-1 5 NS3 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain NS5B 7 unspecified role unspecified role bait bait his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 2 ns3-ns5b--1 3 NS3 8 unspecified role unspecified role prey prey c-terminal fiash label fiash label FIAsH label 4',5'-bis(1,3,2-dithioarsolan-2-yl)fluorescein FIAsH label c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain NS5B 7 unspecified role unspecified role bait bait direct interaction direct interaction 8A confirmation by Coomassie staining. ns3-ns5b-4 3 NS3 8 unspecified role unspecified role prey prey c-terminal fiash label fiash label FIAsH label 4',5'-bis(1,3,2-dithioarsolan-2-yl)fluorescein FIAsH label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain NS5B 7 unspecified role unspecified role bait bait direct interaction direct interaction 8B ns3-ns5b-5 6 NS3 8 unspecified role unspecified role neutral component neutral component c-terminal fiash label fiash label FIAsH label 4',5'-bis(1,3,2-dithioarsolan-2-yl)fluorescein FIAsH label c-term range C-terminal range c-term range c-term range C-terminal range c-term range NS5B 7 unspecified role unspecified role unspecified role unspecified role direct interaction direct interaction 9 ns5b-5 4 NS5B 7 unspecified role unspecified role self self NS5B 7 unspecified role unspecified role self self direct interaction direct interaction supporting information figure 1 ns5b-1 1 NS5B 7 unspecified role unspecified role self self NS5B 7 unspecified role unspecified role self self direct interaction direct interaction supporting information figure 2