MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. EMBO Rep. (1469-221X) 2007 imex curation Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins 2008-11-28 Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2007 2008-11-28 Only protein-protein interactions imex curation The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. EMBO Rep. (1469-221X) 2007 imex curation Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins 2008-11-28 Only protein-protein interactions mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2007 2008-11-28 Only protein-protein interactions imex curation The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. EMBO Rep. (1469-221X) 2007 imex curation Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins 2008-11-28 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2007 2008-11-28 Only protein-protein interactions imex curation The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. EMBO Rep. (1469-221X) 2007 imex curation Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins 2008-11-28 Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2007 2008-11-28 Only protein-protein interactions imex curation The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. EMBO Rep. (1469-221X) 2007 imex curation Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins 2008-11-28 Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down predetermined predetermined participant predetermined Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2007 2008-11-28 Only protein-protein interactions imex curation sap30_mouse Histone deacetylase complex subunit SAP30 30 kDa Sin3-associated polypeptide Sin3 corepressor complex subunit SAP30 Sap30 Sin3-associated polypeptide p30 protein protein mouse Mus musculus Mouse MNGFTPEEMSRGGDAAAAVAAVVAAAAAAASAGNGNAAGGGAEVPGAGAVSASGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH A9D4CBDAB97BBD8C an32a_mouse Acidic leucine-rich nuclear phosphoprotein 32 family member A Potent heat-stable protein phosphatase 2A inhibitor I1PP2A Acidic nuclear phosphoprotein pp32 Leucine-rich acidic nuclear protein Anp32a Anp32 Lanp protein protein mouse Mus musculus Mouse MEMDKRIYLELRNRTPSDVKELVLDNCKSIEGKIEGLTDEFEELEFLSTINVGLTSISNLPKLNKLKKLELSENRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNAYRENVFKLLPQVMYLDGYDRDNKEAPDSDVEGYVEDDDEEDEDEEEYDEYAQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEEAGEEEGSQKRKREPDDEGEEDD 82EEDCF72ECC2918 setbp_mouse SET-binding protein Setbp1 Kiaa0437 protein protein mouse Mus musculus Mouse MEPREMLSSCRQRGSESEFLQGSSSRSPPAPGCSGEPLKGISVGGERMEPEEEDELGSGRDVDCNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNLENYICPPEIKITIKQSGDQKVSRTGKNSKATKEDERNHSKKKLLTAGDPTASDLKAFQTQAYERPQKHSTLQYDPGHSQGFTSDTLKPKHQQKSSSQSHMEWSSNSDSGPATQNCFISPEAGRDTASTSKVPALEPVASFAKAQSKKGSTGGAWSQLSSSSKDLLLGSVVPSPSSHNSPATPSSSAECNGLQPLGDQDGGSTKDLPEPPTLSSKKKSSKKDMISQTLPNSDLDWVKSAQKAFETTEGKREAYSADSAQEASPARQSISSVSNPENDSSHVRITIPIKTPSLDPSNHKRKKRQSIKAVVEKIVPEKALASGISMSSEVVNRILSNSEGSKKDPRVPKLGKMIENETPSVGLETGGNAEKIVPGGASKQRKPPMVMTSPTRTEHAPSGKLSEIQHPKFAAKRRCSKAKPPAMLREAVLATAEKLMVEPPSAYPITPSSPLYTNTDSLTVITPVKKKRGRPKKQPLLTVETIHEGTSTSPVSPISREFPGTKKRKRRRNLAKLAQLVPGEDKPMSEMKFHKKVGKLGVLDKKTIKTINKMKTLKRKNILNQILSCSSSVALKAKAPPETSPGAASIESKLGKQINVSKRGTIYIGKKRGRKPRTELPPPSEEPKTAIKHPRPVSSQPDVPAVPSSFQSPVASSPAAMHPLSTQLGGSNGNLSPASTETNFSELKTMPNLQPISALPTKTQKGIHGGTWKLSPPRLMANSPSHLCEIGSLKEITLSPVSESHSEETIPSDSGIGTDNNSTSDQAEKSSESRRRYSFDFCSLDNPEAIPSDTSTKNRHGHRQKHLIVDTFLAHESLKKPKHKRKRKSLQNRDDLQFLAELEELITKFQVFRISHRGYTFYHENPYPSIFRINFDQYYPVPYIQYDPLLYLRRTSDLKSKKKRGRPAKTNDTMTKVPFLQGFSYPIPSGSYYAPYGMPYTSMPMMNLGYYGQYPAPLYLSHTLGAASPFMRPTVPPPQFHASSHVKISGATKHKAKHGVHLQGTVGMGLGDIQPSLNPPKVGGATLSSSRLHKRKHKHKRKHKEDRILGTHDNLSGLFAGKATGFSSHLLSERLSGSDKELPLVSEKSKHKERQKHQHGEASHKVSKNNFEVDTLSTLSLSDAQHWTQAKDKGDLSSEPVESCAKRYSGSGGDSTRSEGLDVFSEMNPSSDKWDSDMGGSKRRSFEGFGTYREKDIQAFKMNRKERGSYESSMSPGMPSPHLKVDQTAAHSKSEGSISAMMARKKPTAVDSVAIPSAPVLSLLAASAATSDAASSSLKKRFKRREIEAIQCEVRKMCHYTKLLSTKKNLDHVNKILKAKRLQRQSKTGNNFVKKRRGRPRKQPSQFDEDSRDQMPVLEKCIDLPSKRGQKPSLSPLALEPASGQDAVMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPPPPPPLPKTARGGKRKHRPQPPAQPAQPTPQPLPQEEEVKAKRPRKSRASESDVLP mint 783C1FEDFB5FE4F7 e4f1_human Transcription factor E4F1 E4F1 E4F Putative E3 ubiquitin-protein ligase E4F1 E4F transcription factor 1 Transcription factor E4F p120E4F p50E4F RING-type E3 ubiquitin transferase E4F1 protein protein human Homo sapiens Human MEGAMAVRVTAAHTAEAQAEAGREAGEGAVAAVAAALAPSGFLGLPAPFSEEDEDDVHRCGRCQAEFTALEDFVQHKIQKACQRAPPEALPATPATTALLGQEVVPAAPGPEEPITVAHIVVEAASLAADISHASDLVGGGHIKEVIVAAEAELGDGEMAEAPGSPRQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECKLCGASFRTKGSLIRHHRRHTDERPYKCSKCGKSFRESGALTRHLKSLTPCTEKIRFSVSKDVVVSKEDARAGSGAGAAGLGTATSSVTGEPIETSPVIHLVTDAKGTVIHEVHVQMQELSLGMKALAPEPPVSQELPCSSEGSRENLLHQAMQNSGIVLERAAGEEGALEPAPAAGSSPQPLAVAAPQLPVLEVQPLETQVASEASAVPRTHPCPQCSETFPTAATLEAHKRGHTGPRPFACAQCGKAFPKAYLLKKHQEVHVRERRFRCGDCGKLYKTIAHVRGHRRVHSDERPYPCPKCGKRYKTKNAQQVHFRTHLEEKPHVCQFCSRGFREKGSLVRHVRHHTGEKPFKCYKCGRGFAEHGTLNRHLRTKGGCLLEVEELLVSEDSPAAATTVLTEDPHTVLVEFSSVVADTQEYIIEATADDAETSEATEIIEGTQTEVDSHIMKVVQQIVHQASAGHQIIVQNVTMDEETALGPEAAAADTITIATPESLTEQVAMTLASAISEGTVLAARAGTSGTEQATVTMVSSEDIEILEHAGELVIASPEGQLEVQTVIV 60F6E711F2748FD8 hdac2_mouse Histone deacetylase 2 Hdac2 Yy1bp YY1 transcription factor-binding protein protein protein mouse Mus musculus Mouse MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP DIP protein P70288 original sequence version: 83 DIP protein P70288 original sequence version: 123 DIP protein P70288 original sequence version: 112 DIP protein P70288 original sequence version: 99 DIP protein P70288 original sequence version: 155 DIP protein P70288 original sequence version: 117 B9843D24A775157C e4f1_mouse Transcription factor E4F1 E4F transcription factor 1 Putative E3 ubiquitin-protein ligase E4F1 Transcription factor E4F Transcription factor phi AP3 p120E4F E4f1 RING-type E3 ubiquitin transferase E4F1 protein protein mouse Mus musculus Mouse MEGAMAVRVTAAHTAEARAEAGREAGEGGVAAAAALSSGGFLGLPAPFSEEDEDDVHRCGRCQVEFTALEDFVQHKIQKTCHRAPQEALPTTPAATALLDQEVVPTAAEGGPDEPITVAHIVVEATSLAEDISHAPDLVGSGHIKEVIVAAEAEPGDVEMAEAPGSPNHQELGLLGEGEQAHVKLLVNKEGRYVCMLCHKTFKTGSILKAHMVTHSSRKDHECKLCGASFRTKGSLIRHHRRHTDERPYKCAKCGKSFRESGALTRHLKSLTPCTEKIRFSISKDTAVGKEEVPAGSSASTVGTVTSSVAGDPMETSPVIHLVTDAKGTVIHEVHVQMQELPLGMKALTPESPDSEELPCSSENSRENLLHQAMQNSGIVLERVAGEESALEPAPPSGSSPQCLGDGSPELPLLKVEQIETQVASEAATVPRTHPCPQCSETFPTAATLEAHKRGHIAPRPFTCTQCGKAFPKAYLLKKHQEVHVHERRFRCGDCGKLYKTIAHVRGHRRVHSDERPFPCPQCGKRYKTKNAQQVHFRTHLEEKPHVCQFCSRGFREKGSLVRHVRHHTGEKPFKCYKCGRGFAEHGTLNRHLRTKGGCLLEVEELLVSEESPSAAATVLAEDPHTVLVEFSSVVADTQEYIIEATADDTETSEATEIIEGTQTEVDSHIMKVVQQIVHQAGAGHQIIVQNVTMDQETALGSEATAADTITIATPESLTEQVAMTLASAISEGTVLTARAGPNSTEQATVTMVSSEDIEILEHGGELVIASPEGQLEVQTVIV mint 59E47F7A64A224A4 an32a_human Acidic leucine-rich nuclear phosphoprotein 32 family member A ANP32A LANP PHAP1 C15orf1 MAPM Potent heat-stable protein phosphatase 2A inhibitor I1PP2A Acidic nuclear phosphoprotein pp32 Leucine-rich acidic nuclear protein Putative HLA-DR-associated protein I Mapmodulin protein protein human Homo sapiens Human MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD CA2D1A756FBAEA04 anp32a-e4f1 3 E4F 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Lanp 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-4966183: original sequence: 150-247 : RDNKEAPDSDVEGYVEDDDEEDEDEEEYDEYAQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEEAGEEEGSQKRKREPDDEGEED physical association physical association F1 EMBO-Reports mint anp32a-hdac2 3 Lanp 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-4967981: original sequence: 150-247 : RDNKEAPDSDVEGYVEDDDEEDEDEEEYDEYAQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEEAGEEEGSQKRKREPDDEGEED Hdac2 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association NFA EMBO-Reports mint anp32a-sap30 3 Sap30 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Lanp 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-4968439: original sequence: 150-247 : RDNKEAPDSDVEGYVEDDDEEDEDEEEYDEYAQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEEAGEEEGSQKRKREPDDEGEED physical association physical association NFA EMBO-Reports mint anp32a-setbp1 3 Seb1 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Lanp 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-4968465: original sequence: 150-247 : RDNKEAPDSDVEGYVEDDDEEDEDEEEYDEYAQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEEAGEEEGSQKRKREPDDEGEED tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association NFA EMBO-Reports mint anp32a-e4f1-1 4 E4F 9 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Lanp 12 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F2 EMBO-Reports homomint mint e4f1-anp32a 5 Lanp 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined E4F 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F5B F2F EMBO-Reports Interaction decreases when mutant ataxin 1 is overexpressed. homomint mint anp32a-e4f1-2 1 Lanp 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined E4F 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association EMBO-Reports homomint mint F2G e4f1-anp32a-1 2 E4F 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Lanp 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association EMBO-Reports F2H mint anp32a-hdac2-1 3 Hdac2 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined LANP 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association NFA mint anp32a-sap30-1 3 Hdac2 Sap30 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined LANP 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association NFA mint anp32a-setbp1-1 3 SEB1 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined LANP 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association NFA mint