DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The nonstructural protein 8 (nsp8) of the SARS coronavirus interacts with its ORF6 accessory protein. The nonstructural protein 8 (nsp8) of the SARS coronavirus interacts with its ORF6 accessory protein. Virology 2007 imex curation Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus suhonglin@nchu.edu.tw Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins suhonglin@nchu.edu.tw Accepted 2020-JUN-05 AT 11:15 BST AT 11:15 BST by KALPANAP Virology 2007 Only protein-protein interactions imex curation imex curation The nonstructural protein 8 (nsp8) of the SARS coronavirus interacts with its ORF6 accessory protein. The nonstructural protein 8 (nsp8) of the SARS coronavirus interacts with its ORF6 accessory protein. Virology 2007 imex curation Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus suhonglin@nchu.edu.tw Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins suhonglin@nchu.edu.tw Accepted 2020-JUN-05 AT 11:15 BST AT 11:15 BST by KALPANAP Virology 2007 Only protein-protein interactions imex curation imex curation The nonstructural protein 8 (nsp8) of the SARS coronavirus interacts with its ORF6 accessory protein. The nonstructural protein 8 (nsp8) of the SARS coronavirus interacts with its ORF6 accessory protein. Virology 2007 imex curation Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus suhonglin@nchu.edu.tw Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins suhonglin@nchu.edu.tw Accepted 2020-JUN-05 AT 11:15 BST AT 11:15 BST by KALPANAP Virology 2007 Only protein-protein interactions imex curation imex curation The nonstructural protein 8 (nsp8) of the SARS coronavirus interacts with its ORF6 accessory protein. The nonstructural protein 8 (nsp8) of the SARS coronavirus interacts with its ORF6 accessory protein. Virology 2007 imex curation Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus suhonglin@nchu.edu.tw Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins suhonglin@nchu.edu.tw Accepted 2020-JUN-05 AT 11:15 BST AT 11:15 BST by KALPANAP Virology 2007 Only protein-protein interactions imex curation imex curation q19qw5_sars Accessory protein 6 ORF6 sars6 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP 70C9150941C759BF p0c6x7-pro_0000037315 Non-structural protein 8 ORF1ab polyprotein 1a-1b rep protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus AIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQ 3920 4117 E5D5A7840B20D23A orf6-1 2 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed yeast Saccharomyces cerevisiae Baker's yeast 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig 2 orf6-rep-1 3 5 autoradiography autoradiography experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range S35 S35 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 autoradiography autoradiography experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range S35 S35 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig 3b rep-orf6-1 3 5 autoradiography autoradiography predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range S35 S35 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 autoradiography autoradiography predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range S35 S35 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig 3b orf6-rep-2 1 5 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] physical association physical association Fig 5 orf6-rep-3 4 5 immunocytochemistry immunocytochemistry experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] 6 immunocytochemistry immunocytochemistry experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] colocalization colocalization Fig 6