MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. J. Virol. (0022-538X) 2007 rapid curation Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins manually identified rapid curation unknown Unknown protein kinase assay protein kinase assay predetermined predetermined participant predetermined Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins manually identified manually identified J. Virol. (0022-538X) 2007 rapid curation rapid curation The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. J. Virol. (0022-538X) 2007 rapid curation Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins manually identified rapid curation unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins manually identified manually identified J. Virol. (0022-538X) 2007 rapid curation rapid curation The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. J. Virol. (0022-538X) 2007 rapid curation Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins manually identified rapid curation unknown Unknown fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins manually identified manually identified J. Virol. (0022-538X) 2007 rapid curation rapid curation The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. J. Virol. (0022-538X) 2007 rapid curation Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins manually identified rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins manually identified manually identified J. Virol. (0022-538X) 2007 rapid curation rapid curation a7y3z3_hpv16 protein protein hpv16 Human papillomavirus type 16 MADPAAATKYPLLKLLGSTWPTTPPRPIPKPSPWAPKKHRRLSSDQDQSQTPETPATPLSCCTETQWTVLQSSLHLTAHTKDGLTVIVTLHP mint BFF1A9F53AFF63A6 srpk1_human SRSF protein kinase 1 Serine/arginine-rich protein-specific kinase 1 SFRS protein kinase 1 SRPK1 protein protein human Homo sapiens Human MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQKRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGGAAEINCNGVIEVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSEVSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLVNPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS DIP protein Q96SB4 original sequence version: 128 900E980FE1C16B9A a7y3z3-srpk1 4 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association F1 F3 homomint mint srpk1-a7y3z3 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association F2 F4 homomint mint srpk1-a7y3z3-1 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association F5 homomint mint srpk1-a7y3z3-2 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait phosphorylation phosphorylation reaction phosphorylation F6 F7 homomint mint