MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Human papillomavirus-16 E7 interacts with Siva-1 and modulates apoptosis in HaCaT human immortalized keratinocytes. Human papillomavirus-16 E7 interacts with Siva-1 and modulates apoptosis in HaCaT human immortalized keratinocytes. J. Cell. Physiol. (0021-9541) 2007 rapid curation Severino A., Abbruzzese C., Manente L., Valderas AA., Mattarocci S., Federico A., Starace G., Chersi A., Mileo AM., Paggi MG. Virus - Publications including interactions involving viral proteins manually identified rapid curation unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Severino A., Abbruzzese C., Manente L., Valderas AA., Mattarocci S., Federico A., Starace G., Chersi A., Mileo AM., Paggi MG. Virus - Publications including interactions involving viral proteins manually identified manually identified J. Cell. Physiol. (0021-9541) 2007 rapid curation rapid curation Human papillomavirus-16 E7 interacts with Siva-1 and modulates apoptosis in HaCaT human immortalized keratinocytes. Human papillomavirus-16 E7 interacts with Siva-1 and modulates apoptosis in HaCaT human immortalized keratinocytes. J. Cell. Physiol. (0021-9541) 2007 rapid curation Severino A., Abbruzzese C., Manente L., Valderas AA., Mattarocci S., Federico A., Starace G., Chersi A., Mileo AM., Paggi MG. Virus - Publications including interactions involving viral proteins manually identified rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Severino A., Abbruzzese C., Manente L., Valderas AA., Mattarocci S., Federico A., Starace G., Chersi A., Mileo AM., Paggi MG. Virus - Publications including interactions involving viral proteins manually identified manually identified J. Cell. Physiol. (0021-9541) 2007 rapid curation rapid curation Human papillomavirus-16 E7 interacts with Siva-1 and modulates apoptosis in HaCaT human immortalized keratinocytes. Human papillomavirus-16 E7 interacts with Siva-1 and modulates apoptosis in HaCaT human immortalized keratinocytes. J. Cell. Physiol. (0021-9541) 2007 rapid curation Severino A., Abbruzzese C., Manente L., Valderas AA., Mattarocci S., Federico A., Starace G., Chersi A., Mileo AM., Paggi MG. Virus - Publications including interactions involving viral proteins manually identified rapid curation unknown Unknown peptide array peptide array predetermined predetermined participant predetermined Severino A., Abbruzzese C., Manente L., Valderas AA., Mattarocci S., Federico A., Starace G., Chersi A., Mileo AM., Paggi MG. Virus - Publications including interactions involving viral proteins manually identified manually identified J. Cell. Physiol. (0021-9541) 2007 rapid curation rapid curation siva_human Apoptosis regulatory protein Siva CD27-binding protein SIVA1 SIVA protein protein human Homo sapiens Human MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET DB62B7DF4E6B39B3 ve7_hpv16 Protein E7 E7 protein protein hpv16 Human papillomavirus type 16 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP DIP protein P03129 original sequence version: 96 9BD612534CD2C9EB siva1-e7 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association F1 F4 homomint mint e7-siva1 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association homomint mint siva1-e7-1 3 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association F2 homomint mint e7-siva1-1 3 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association F3 homomint mint