UniProt UniProt http://www.uniprot.org Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). Virology (0042-6822) 2007 imex curation Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de Accepted 2014-MAY-19 by MGT HEK293 cDNA Virology (0042-6822) 2007 Only protein-protein interactions imex curation Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). Virology (0042-6822) 2007 imex curation Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de Accepted 2014-MAY-19 by MGT Virology (0042-6822) 2007 Only protein-protein interactions imex curation Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). Virology (0042-6822) 2007 imex curation Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de Accepted 2014-MAY-19 by MGT Virology (0042-6822) 2007 Only protein-protein interactions imex curation Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). Virology (0042-6822) 2007 imex curation Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de Accepted 2014-MAY-19 by MGT Virology (0042-6822) 2007 Only protein-protein interactions imex curation rep68_aav2s Protein Rep68 Rep68 protein protein aav-2 Adeno-associated virus 2 (isolate Srivastava/1982) AAV-2 MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDECYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRLARGHSL Essential for DNA replication mint 7C1ECDD4E07703C8 kctd5_human BTB/POZ domain-containing protein KCTD5 KCTD5 protein protein human Homo sapiens Human MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM 22097CF5F41CD43D rep78_aav2s Protein Rep78 Rep78 protein protein aav-2 Adeno-associated virus 2 (isolate Srivastava/1982) AAV-2 MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDECYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRYQNKCSRHVGMNLMLFPCRQCERMNQNSNICFTHGQKDCLECFPVSESQPVSVVKKAYQKLCYIHHIMGKVPDACTACDLVNVDLDDCIFEQ FBF4F1FEAF48FF2A rep-kctd5 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association no figure rep-kctd5-1 2 5 unspecified role unspecified role bait bait dna_binding_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain nls_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2B and C rep-kctd5-2 4 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Rep68 NLS mutant also interacted. 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4 A/B , 7, 8 q89268-kctd5-2 4 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Rep78 NLS mutant also interacted. physical association physical association 4A and 7 q89268-kctd5-1 3 7 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection Rep78 NLS mutant also interacted. 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 E and 8G