MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. EMBO J. (0261-4189) 2006 imex curation Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 2009-01-08 Only protein-protein interactions chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. EMBO J. (0261-4189) 2006 imex curation Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 2009-01-08 Only protein-protein interactions in vitro In vitro cosedimentation cosedimentation nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. EMBO J. (0261-4189) 2006 imex curation Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 2009-01-08 Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. EMBO J. (0261-4189) 2006 imex curation Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 2009-01-08 Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. EMBO J. (0261-4189) 2006 imex curation Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility. EMBO J. (0261-4189) 2006 imex curation Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 2009-01-08 Only protein-protein interactions chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Zhang M., Liu J., Cheng A., Deyoung SM., Chen X., Dold LH., Saltiel AR. Virus - Publications including interactions involving viral proteins SH3 EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation vinc_human Vinculin Metavinculin VCL protein protein human Homo sapiens Human MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAELCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQDLLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEGIQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQPVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ DIP protein P18206 original sequence version: 126 BFBD687DA836B0FA q62417-2 Sorbin and SH3 domain-containing protein 1 Sorbs1 Kiaa1296 Ponsin SH3 domain protein 5 SH3P12 Sh3d5 c-Cbl-associated protein CAPsm protein protein mouse Mus musculus Mouse MSSECDVGSSKAVVNGLASGNHGPDKDMDPTKICTGKGTVTLRASSSYRGTPSSSPVSPQESPKHESKSDEWKLSSSADTNGNAQPSPLAAKGYRSVHPSLSADKPQGSPLLNEVSSSHIETDSQDFPPTSRPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPASERRAGEQDPVPTPAELTSPGRASERRAKDASRRVVRSAQDLSDVSTDEVGIPLRNTERSKDWYKTMFKQIHKLNRDDDSDVHSPRYSFSDDTKSPLSVPRSKSEMNYIEGEKVVKRSATLPLPARSSSLKSSPERNDWEPLDKKVDTRKYRAEPKSIYEYQPGKSSVLTNEKMSSAVSPTPDITSEPPGYIYSSNFHAVKRESDGTPGGLASLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPADYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLNIDDTAKRKSGLEMRPARAKFDFKAQTLKELPLQKGDVVYIYRQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPRKLAPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVLKRPLVKTPVDYIDLPYSSSPSRSATVSPQQPQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTRQFGTFPGNYVKPLYL Contains a phosphoserine at position 164. Contains a phosphoserine at position 346. mint 9C221599664DB85C paxi_human Paxillin PXN protein protein human Homo sapiens Human MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGGRSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC DIP protein P49023 original sequence version: 115 DIP protein P49023 original sequence version: 126 DIP protein P49023 original sequence version: 169 DIP protein P49023 original sequence version: 140 DIP protein P49023 original sequence version: 175 ABF6C0BE5939623F actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 pxn-sorbs1 6 8 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:13:15 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Thr610Phe range MINT-3383365: original sequence: 610-610 : ITLLRQVDENWYEGRIPGTS myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:13:08 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Thr536Phe range MINT-3383362: original sequence: 536-536 : VYIYRQIDQNWYEGEHHGRV Stoichiometry: 1.0 9 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F3A EMBO-Journal Human Up_Ids for paxillin and vinculin have been used. mint pxn-sorbs1-1 6 8 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 9 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F1B EMBO-Journal Human Up_Ids for paxillin and vinculin have been used. Interaction occurs also in REF52 cells. mint sorbs1-pxn 1 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F2A EMBO-Journal Human Up_Ids for paxillin and vinculin have been used. mint sorbs1-vcl 1 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F2A EMBO-Journal Human Up_Ids for paxillin and vinculin have been used. mint sorbs1-pxn-1 3 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:05:41 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 48-57 range MINT-3383130: original sequence: 48-57 : HTYQEIAVPPPVPPPPSSEALNGTILDPL Stoichiometry: 1.0 physical association physical association F2B EMBO-Journal Human Up_Ids for paxillin and vinculin have been used. mint sorbs1-vcl-1 3 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:05:49 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Thr610Phe range MINT-3383319: original sequence: 610-610 : ITLLRQVDENWYEGRIPGTS myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:05:54 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Thr536Phe range MINT-3383316: original sequence: 536-536 : VYIYRQIDQNWYEGEHHGRV binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3383323: original sequence: 446-683 : LLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLNIDDTAKRKSGLEMRPARAKFDFKAQTLKELPLQKGDVVYIYRQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPRKLAPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVLKRPLVKTPVDYIDLPYSSSPSRSATVSPQQPQAQQRRVTPDRSQPSLDLC Stoichiometry: 1.0 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F2D EMBO-Journal Human Up_Ids for paxillin and vinculin have been used. mint sorbs1-pxn-2 3 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:07:10 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Thr536Phe range MINT-3383332: original sequence: 536-536 : VYIYRQIDQNWYEGEHHGRV binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3383335: original sequence: 446-683 : LLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLNIDDTAKRKSGLEMRPARAKFDFKAQTLKELPLQKGDVVYIYRQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPRKLAPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVLKRPLVKTPVDYIDLPYSSSPSRSATVSPQQPQAQQRRVTPDRSQPSLDLC undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:07:04 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Thr610Phe range MINT-3383329: original sequence: 610-610 : ITLLRQVDENWYEGRIPGTS Stoichiometry: 1.0 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2D EMBO-Journal Human Up_Ids for paxillin and vinculin have been used. mint sorbs1-vcl-2 5 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3383251: original sequence: 446-577 : LLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLNIDDTAKRKSGLEMRPARAKFDFKAQTLKELPLQKGDVVYIYRQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPRKLAPVQVLEYG Stoichiometry: 1.0 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F2C EMBO-Journal Human Up_Ids for paxillin and vinculin have been used. mint sorbs1-pxn-3 5 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3383236: original sequence: 446-577 : LLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLNIDDTAKRKSGLEMRPARAKFDFKAQTLKELPLQKGDVVYIYRQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPRKLAPVQVLEYG Stoichiometry: 1.0 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F2C EMBO-Journal Human Up_Ids for paxillin and vinculin have been used. mint sorbs1-pxn-4 5 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3383271: original sequence: 446-577 : LLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLNIDDTAKRKSGLEMRPARAKFDFKAQTLKELPLQKGDVVYIYRQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPRKLAPVQVLEYG gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:07:58 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 48-57 range MINT-3383289: original sequence: 48-57 : HTYQEIAVPPPVPPPPSSEALNGTILDPL Stoichiometry: 1.0 physical association physical association SF1 EMBO-Journal Human Up_Ids for paxillin and vinculin have been used. mint pxn-sorbs1-2 4 8 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F3B EMBO-Journal Human Up_Ids for paxillin and vinculin have been used. mint actb-sorbs1 2 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-4051474: original sequence: 341-405 : MSSAVSPTPDITSEPPGYIYSSNFHAVKRESDGTPGGLASLENERQIYKSVLEGGDIPLQGLSG 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 direct interaction direct interaction SF3 EMBO-Journal mint