MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Growth transformation of human T cells by herpesvirus saimiri requires multiple Tip-Lck interaction motifs. Growth transformation of human T cells by herpesvirus saimiri requires multiple Tip-Lck interaction motifs. J. Virol. (0022-538X) 2006 Heck E., Friedrich U., Gack MU., Lengenfelder D., Schmidt M., Müller-Fleckenstein I., Fleckenstein B., Ensser A., Biesinger B. Virus - Publications including interactions involving viral proteins in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Heck E., Friedrich U., Gack MU., Lengenfelder D., Schmidt M., Müller-Fleckenstein I., Fleckenstein B., Ensser A., Biesinger B. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2006 Growth transformation of human T cells by herpesvirus saimiri requires multiple Tip-Lck interaction motifs. Growth transformation of human T cells by herpesvirus saimiri requires multiple Tip-Lck interaction motifs. J. Virol. (0022-538X) 2006 Heck E., Friedrich U., Gack MU., Lengenfelder D., Schmidt M., Müller-Fleckenstein I., Fleckenstein B., Ensser A., Biesinger B. Virus - Publications including interactions involving viral proteins human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Heck E., Friedrich U., Gack MU., Lengenfelder D., Schmidt M., Müller-Fleckenstein I., Fleckenstein B., Ensser A., Biesinger B. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2006 lck_human Tyrosine-protein kinase Lck Protein YT16 Proto-oncogene Lck T cell-specific protein-tyrosine kinase LCK Lymphocyte cell-specific protein-tyrosine kinase p56-LCK Leukocyte C-terminal Src kinase protein protein human Homo sapiens Human MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP DIP protein P06239 original sequence version: 164 DIP protein P06239-1 original sequence version: 193 44BFF0D43FFB420D cd4_human T-cell surface glycoprotein CD4 CD4 T-cell surface antigen T4/Leu-3 protein protein human Homo sapiens Human MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI DIP protein P01730 original sequence version: 183 DIP protein P01730 original sequence version: 163 DIP protein P01730 original sequence version: 133 DIP protein P01730 original sequence version: 135 DIP protein P01730 original sequence version: 185 DIP protein P01730 original sequence version: 189 20ED893F9E56D236 tip_shv2c Tyrosine-protein kinase-interacting protein protein protein shv2c Saimiriine herpesvirus 2 (strain 488) (SaHV-2) Herpesvirus saimiri MANEGEEIELTEFPETEKERKDEEKLSSCSEETTNTSSSSGSDHVPVPIEVNVIIQNSSRTEDELQNSKEIELTGFQGKLSSCSEETTAPSSSYSSKQASVFIEENGDNETSTYRPQNVLTNLNSLYTTFEDARAQGKGMVRHKSEDLQSFLEKYPPDFRKPKRDLSATWDPGMPTPPLPPRPANLGERQASTVRLHVKESNCKQPRERKANERNIVKDLKRLENKINVIICLVVVILAVLLLVTVLSILHIGMKS E04BA49D27A59D3A cd4-lck 2 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1B homomint mint cd4-tip 2 5 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P22575:p.Pro178Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:56:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:20:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro178ala' Tue Jun 30 19:51:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro178Ala' range MINT-3375659: original sequence: 178-178 : ATWDPGMPTPPLPPRPANLG tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P22575:p.Pro175Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:18:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:08:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro175ala' Tue Jun 30 15:41:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro175Ala' range MINT-3375653: original sequence: 175-175 : DLSATWDPGMPTPPLPPRPA P22575:p.Pro180Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:56:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 14:44:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro180ala' Tue Jun 30 17:20:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro180Ala' range MINT-3375662: original sequence: 180-180 : WDPGMPTPPLPPRPANLGER P22575:p.Pro183Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:18:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:22:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro183ala' Tue Jun 30 15:44:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro183Ala' range MINT-3375665: original sequence: 183-183 : GMPTPPLPPRPANLGERQAS undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:43:26 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 177 range MINT-3375656: original sequence: 177-177 : SATWDPGMPTPPLPPRPANL undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:43:26 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Pro146-155Ala range MINT-3376062: original sequence: 146-155 : QGKGMVRHKSEDLQSFLEKYPPDFRKPKR Stoichiometry: 1.0 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1B homomint mint lck-tip 2 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:12:36 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 146-155 range MINT-3376067: original sequence: 146-155 : QGKGMVRHKSEDLQSFLEKYPPDFRKPKR P22575:p.Pro178Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:18:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:55:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro178ala' Tue Jun 30 15:55:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro178Ala' range MINT-3375812: original sequence: 178-178 : ATWDPGMPTPPLPPRPANLG P22575:p.Pro177Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:55:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:40:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro177ala' Tue Jun 30 20:23:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro177Ala' range MINT-3375821: original sequence: 177-177 : SATWDPGMPTPPLPPRPANL P22575:p.Pro183Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:18:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:47:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro183ala' Tue Jun 30 20:25:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro183Ala' range MINT-3375815: original sequence: 183-183 : GMPTPPLPPRPANLGERQAS P22575:p.Pro175Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:18:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:51:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro175ala' Tue Jun 30 16:54:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro175Ala' range MINT-3375809: original sequence: 175-175 : DLSATWDPGMPTPPLPPRPA tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P22575:p.Pro180Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:18:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:21:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro180ala' Tue Jun 30 19:13:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro180Ala' range MINT-3375818: original sequence: 180-180 : WDPGMPTPPLPPRPANLGER Stoichiometry: 1.0 physical association physical association F1B homomint mint tip-lck 2 5 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P22575:p.Pro177Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:55:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:20:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro177ala' Tue Jun 30 15:51:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro177Ala' range MINT-3375847: original sequence: 177-177 : SATWDPGMPTPPLPPRPANL P22575:p.Pro175Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:21:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:42:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro175ala' Tue Jun 30 19:18:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro175Ala' range MINT-3375835: original sequence: 175-175 : DLSATWDPGMPTPPLPPRPA P22575:p.Pro183Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:21:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:57:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro183ala' Tue Jun 30 17:33:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro183Ala' range MINT-3375841: original sequence: 183-183 : GMPTPPLPPRPANLGERQAS undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:45:40 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 146-155 range MINT-3376071: original sequence: 146-155 : QGKGMVRHKSEDLQSFLEKYPPDFRKPKR tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P22575:p.Pro180Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:21:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:36:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro180ala' Tue Jun 30 16:02:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro180Ala' range MINT-3375844: original sequence: 180-180 : WDPGMPTPPLPPRPANLGER P22575:p.Pro178Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:21:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:22:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro178ala' Tue Jun 30 19:14:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro178Ala' range MINT-3375838: original sequence: 178-178 : ATWDPGMPTPPLPPRPANLG Stoichiometry: 1.0 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1B homomint mint lck-tip-1 1 5 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:45:21 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 146-154 range MINT-3376075: original sequence: 146-154 : QGKGMVRHKSEDLQSFLEKYPPDFRKPK tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P22575:p.Pro178Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:21:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:21:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro178ala' Tue Jun 30 17:44:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro178Ala' range MINT-3375869: original sequence: 178-178 : ATWDPGMPTPPLPPRPANLG P22575:p.Pro177Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:20:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:28:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro177ala' Tue Jun 30 15:45:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro177Ala' range MINT-3375872: original sequence: 177-177 : SATWDPGMPTPPLPPRPANL P22575:p.Pro180Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:57:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:14:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro180ala' Tue Jun 30 19:00:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro180Ala' range MINT-3375878: original sequence: 180-180 : WDPGMPTPPLPPRPANLGER P22575:p.Pro175Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:57:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:47:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro175ala' Tue Jun 30 20:01:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro175Ala' range MINT-3375875: original sequence: 175-175 : DLSATWDPGMPTPPLPPRPA P22575:p.Pro183Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:21:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:34:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro183ala' Tue Jun 30 19:21:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro183Ala' range MINT-3375881: original sequence: 183-183 : GMPTPPLPPRPANLGERQAS Stoichiometry: 1.0 3 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate Stoichiometry: 1.0 physical association physical association F2 homomint mint lck-tip-2 1 3 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3375928: original sequence: 63-118 : DNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVA Stoichiometry: 1.0 5 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:47:14 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 146-155 range MINT-3376079: original sequence: 146-155 : QGKGMVRHKSEDLQSFLEKYPPDFRKPKR Stoichiometry: 1.0 physical association physical association F2 homomint mint