HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Subproteomic study of hepatitis C virus replicon reveals Ras-GTPase-activating protein binding protein 1 as potential HCV RC component. Subproteomic study of hepatitis C virus replicon reveals Ras-GTPase-activating protein binding protein 1 as potential HCV RC component. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Yi Z., Fang C., Pan T., Wang J., Yang P., Yuan Z. Virus - Publications including interactions involving viral proteins pyyang@fudan.edu.cn 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Yi Z., Fang C., Pan T., Wang J., Yang P., Yuan Z. Virus - Publications including interactions involving viral proteins pyyang@fudan.edu.cn Accepted 2013-DEC-12 by ORCHARD Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation p27958-pro_0000037576 Non-structural protein 5A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SGSWLRDIWDWICEVLSDFKTWLKAKLMPQLPGIPFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCKNMWSGTFFINAYTTGPCTPLPAPNYKFALWRVSAEEYVEIRRVGDFHYVSGMTTDNLKCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLHEYPVGSQLPCEPEPDVAVLTSMLTDPSHITAEAAGRRLARGSPPSMASSSASQLSAPSLKATCTANHDSPDAELIEANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREVSVPAEILRKSRRFAPALPVWARPDYNPLLVETWKKPDYEPPVVHGCPLPPPRSPPVPPPRKKRTVVLTESTLPTALAELATKSFGSSSTSGITGDNTTTSSEPAPSGCPPDSDVESYSSMPPLEGEPGDPDLSDGSWSTVSSGADTEDVVCC 1973 2420 106ED331CF52DACA vapa_human Vesicle-associated membrane protein-associated protein A VAPA VAP33 33 kDa VAMP-associated protein protein protein human Homo sapiens Human MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL DIP protein Q9P0L0 original sequence version: 136 DIP protein Q9P0L0 original sequence version: 130 68B603F3A9FA5475 ns5a-vap33-3 1 VAP-33 3 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5A 2 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 2B